Conserved Protein Domain Family
PHA02996

?
PHA02996: PHA02996 
poly(A) polymerase large subunit; Provisional
Statistics
?
PSSM-Id: 177503
View PSSM: PHA02996
Aligned: 25 rows
Threshold Bit Score: 730.3
Threshold Setting Gi: 115531718
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
41057454    1 MAPPVIEEYLGSRPSMERCVLLRAQRRAMTRVLNFDRKLFLSLVVKSRRRFFKKLGGSEKEIAARIEEYFTRQTRLEKLG 80 
9634772     6 QVYYIINEYLGRHPSSTEYQVLKHQVEKISKINNFNKETFFFLLKKNKNKFFKDLELSDDLLKKRIDEYFSKQKHAKRLG 85 
12085015    4 SITLTLKNYLGRMPTINEYHMLKSQVRNIQKIMFFNKDIFISLIKKNKKKFFSEIKSSPSEIKTHILEYFLKQQKTSSIG 83 
9628963     4 AQFELLREYLGRPPTLNQYFIFKPQARAIQRIMRFDTDVFFALIKKNKKRFFARIGGSASEINARVLSYFVKQRATTKVG 83 
38229195    4 SITLTLKNYLGRMPTVNEYYMLKSQVRNIQKIMFFNKDIFISLIKKNKKKFFYEIKSSPSEMRLHILEYFMKQQKTSSIG 83 
40556067    6 QITSVIREYLGRNPVPKEYEVLKKQTLKLSKIINFNKDTFFFLIKKNKYTFFKDLNVSDEEIQERIDEYFTKQRRARRLG 85 
41057081    1 MAPPVIEEYLGSRPSMERCVLLRAQRRNMSRVLNFDRKLFLSLVVKSRRRFFKKLGGSEKEIAARIEEYFSRQRRLEKLG 80 
62637418    4 HISEILEKYLGRIPSLTEYHTLKSQYKNIHRVNIFNKDIFISLIKKNKKKFFSDIDTSVSEIKKLVFDYFTKQEQTYSIG 83 
157939654   4 SITLTLKNYLGRMPTINEYHMLKSQVRNIQKIMFFNKDIFISLIKKNKKKFFSEIKSSPSEIKTHILEYFLKQQKTSSIG 83 
211956312   4 HISEILEKYLGRIPSLTEYHTLKSQYKNIHRVNIFNKDIFISLIKKNKKKFFSDIDTSVSEIKKLVFDYFTKQEQTYSIG 83 
41057454   81 QILTVLELQSVIVTEFTKTVGSLTSPMPAINAAVRRVDVSPAKDLTRRALESYMVLQPPagEpAAMARHKHSDLVDVVKR 160
9634772    86 NLFAIMELQKILISSFTKTIGILTTKVPEYYHSTIKLEYSSMEKIADDILDSYNVVEPS--K-EVKGRHKVSDLVGHVYK 162
12085015   84 KLYTIIELQTILVSSYTDVLGVLTTKSPYVFPSNIKYEPHSMKKIAHDILTSINVATIS--E-KVMGRHNVSNLVTNVNL 160
9628963    84 RILSIIELQSVLVNSYTEIMGVLTLPAPPVYNSVVRLHYCSMERLAEEVLWSYNVAFRS--G-KVMGRHCVSNLVVHVNK 160
38229195   84 KLYAIIELQTILVSTYTDVLGVLTTKAPYVFPSNVRYEPRSMKKIAHDILTTINVATVS--E-KVMGRHNVSELVTNVNL 160
40556067   86 NLLAIVELQKLLVSSFTKTLGVLTTKALEYYPSNIRLDYSFMEKIADNILDSYNVVKPS--E-EVKGRHKVSDLVLHVNK 162
41057081   81 QILTVLELQSVIVGEFTRTLGSLTTPTPAINAAVRRVDATRARALASRALDSYAVLPPPe-EaAPMARHKHSDLVEVVKR 159
62637418   84 KLYTIIELQTILVTTYTDILGVLTTKGPDIFSSNVQYNTSSMQKIANDALNSMNIATIS--D-KVMGRHNVSSLVCNVNS 160
157939654  84 KLYTIIELQTILVSSYTDVLGVLTTKSPYVFPSNIKYEPHSMKKIAHDILTSINVATIS--E-KVMGRHNVSNLVTNVNL 160
211956312  84 KLYTIIELQTILVTTYTDILGVLTTKGPDIFSSNVQYNTSSMQKIASDALNSMNIATIS--D-KVMGRHNVSSLVCNVNS 160
41057454  161 LMKEHLRRNNKRCVCYGSYSLHLLNPEIEYGDIDMVQTNARPFLINLAFLIYFVTGRQTVLLRVPYLKSYVVLQDEEGGH 240
9634772   163 IMEEYLRRHSNSCLCYGSYSLHFLNNKIEYGDIDVLQTNARTFLINIAFLIKFITGRRIVLLKVPFLKNYVIMHDEETNH 242
12085015  161 LMEEYLRRHNKSCICYGSYSLYLLNPSIKYGDIDILQTNSRIFLINLAFLIKFITGHNVMLLKVPYLKNYMVLRDNEDKH 240
9628963   161 LMSEYLRRHNRTAICYGSYSLHLLNSRIEYGDIDILQTNARLFLINLAFLIYFITGRNVLLLKVPYLKSYIVMQDEEGRH 240
38229195  161 LMEEYLRRHNKSCICYGSYSLYLLNPSIEYGDIDIMQTNSRIFLINLAFLIKFITGHNVMLLKVPYLKNYMVLRDDEDKH 240
40556067  163 IMEEYLRRHSNSCICYGSYSLHLLNKKIEYGDIDILQTNARIFLINIAFLIRFITGRCVVLLKVPFLKNYVVIHDENLNH 242
41057081  160 LVKEHLRRHNKRCVCYGSYALHLLNPEIEYGDIDMVQTNARPFLINLAFLIYFVTGRQTVLLRVPYLKNYVVLQDEEGGH 239
62637418  161 LMEEYLRRHNKSCICYGSYSLHLLNPEIKYGDIDILQTNSRTFLIDLAFLIKFITGYNVILLKVPYLKNYMVLKDQNDSH 240
157939654 161 LMEEYLRRHNKSCICYGSYSLYLLNPSIKYGDIDILQTNSRIFLINLAFLIKFITGHNVMLLKVPYLKNYMVLRDNEDKH 240
211956312 161 LMEEYLRRHNKSCICYGSYSLHLLNPEIKYGDIDILQTNSRTFLIDLAFLIKFITGYNVILLKVPYLKNYMVLKDQNDSH 240
41057454  241 ILDSFNVRQATLRALPTLQVDNIYILHPFVQLMAALKMFSQTDRIFDLVENFDKARARMETLLAFAMEELECRPPVAEps 320
9634772   243 VMDTFNIREKTMNMIPKIMIDNMYIVDPCIQLLNMIKMLSQIDRLEELQAKFEKLSVRLGTLLEYTRYRYSIPLDSE--- 319
12085015  241 IIDSFNVRQETMHAIPKILIDNIYIVDPTFQLLSMIKMFSQIDRLEDLAKNQEKATIKLATLLEYVRIKHGIILNGNV-- 318
9628963   241 IIDSFNIRQGTMQNVPKVLVDNIYIIDPVVQLMNTLKMLSQIDRLEDLGERMAKMRLRLATLLEYARYHHCVSFGGG--- 317
38229195  241 IIDSFNVRQDTMHSIPKILIDNIYIVDPTFQLLSMIKMFSQVDRLEDLARNQEKATIKLATLLEYVRVKHGIIFNGKV-- 318
40556067  243 VMDSFNIKQSTMDKIPKIMIDNMYIVDPCIQLLNTIKMFSQIDRLEDIHTKFDKLSIRLGTLLEYTRYRYSILLDSE--- 319
41057081  240 ILDSFNVRQATLRALPTLLVDNIYVLHPFVQLMAMLKMFSQTDRVRDLASNFDKARARMETLLAFALEELGEAPADGR-- 317
62637418  241 IIDSFNIRQETMQHIPKILIDNIYIVDPTIQLLSMLKMLSQIDRLEDLAKNPDKLTIRFATLLEYVRNKYGIILNGNS-- 318
157939654 241 IIDSFNVRQETMNAIPKILIDNIYIVDPTFQLLSMIKMFSQIDRLEDLAKNQEKATIKLATLLEYVRIKHGIILNGNV-- 318
211956312 241 IIDSFNIRQETMQHIPKVLIDNIYIVDPTIQLLSMLKMLSQIDRLEDLAKNPDKLTIRFATLLEYVRNKYGIILNGNS-- 318
41057454  321 DRMPLPCAFarpadpdeSAGSRVLEVDASAHAFGFSRAVVFLDEPVLVQKILDLGVpeDDIVDFESVSNSAFLVHGDTLY 400
9634772   320 SILEVRAKL--------DKDKRKITVDFKKYKLNYIKCYFYLDEVELKKFISKNSGl-DEYEDFEAVTNSEYAIRNKTMY 390
12085015  319 TNMPMPASF--------NYEKRIVTVDASKYNFSFKKCFVYLDENSLSSDILDLNA--DDAIDFENVSNSVFLINDEVMY 388
9628963   318 ARLRLHMRL--------DAGARIVLVDTRCYGLGYRECRCYLDEARLLQDISKLNAd-AAVVDFEAVSNSVFLIHQGIMY 388
38229195  319 TNMPMPSSF--------DHEKRIITVDTSRYNFSFKKCFVYLDENSLSSDILNLNA--DDAIDFENVSNSVFLINDEIMY 388
40556067  320 SILDVKYKI--------DIQNRKIILDFKKYNLNYIKCYFFLDEDEL-KKLIRKTPktDDYIDLEAVTNSEYMILNKTMY 390
41057081  318 --TPLPCAFlp----peGGASRVLEADARALDCGFARAVVFLDEPALVQTLLDMGVqdDEIVDFESVSNSAFLVRDNTLF 391
62637418  319 NNMPMPSTI--------DIKKRIITVDTKYYNFAYDKCYVYLDENSLSSDILSLNA--DDAVDFENVSNSAFLVNDKTLY 388
157939654 319 TNMPMPASF--------NYERRIVTVDASKYNFSFKKCFVYLDENSLSSDILDLNA--DDAIDFENVSNSVFLINDEVMY 388
211956312 319 NNMPMPATI--------DIKKRIITVDTKYYNFAYDKCYVYLDENSLSSDILSLNA--DDAVDFENVSNSAFLVNDKTLY 388
41057454  401 THFSNTVLM-DGDAVHDISRRAVTAHIVMFLLLTRHPAAEAAVREMLSTLVSTGRRVTAVVERSKKSGTHGVIDITRNVI 479
9634772   391 TYFSNTALMrSENEIHPITINALTSHALLYHVITRKFYDDLLGDLVRSLMIVEKVPVFKIIPRDKKQGRHTIIDIEKDII 470
12085015  389 TYFSNTILMsSKNEIHEISARGVSAHILMYQILTDGDFLIPLSDIINSLMFKEKTPIFNIIPRDKKTGKHGIINIEKDII 468
9628963   389 TYFSNTVLLrSEDAIHDVSERAVCAHITLYHLLVGCNYQELLADLLNSLVSREKCPVVGVVARDKKVGRHGVIDIEKDVI 468
38229195  389 TYFSNTILMsSKDEIHEISARGVSAHILMYQILTDGDYLIPLSDIVNSLMFKEKIPIFSIIPRDKKTGKHGIINIEKDII 468
40556067  391 TYFSNTTLLrSKDELHPITINALTSHALLYHVITKKFYDDLLGDLIRSLMIVEKVPVYEIIPRDKKRGKHTIIDIEKDVV 470
41057081  392 TYFSNTVLM-DGDAVHDLSRRGVSAHIVMFLLLTRHPAAEGAVRSMLGSLVSDARPVTGVVERERKTGTHGVIDIAKNVI 470
62637418  389 TYFSNTILLsGNDKIHEISSRGISAHILIYQALMKYDISIPLTDIVNSLIGRNKQPIYEIIPRDKKTGKHGIIDIEKDII 468
157939654 389 TYFSNTILMsSKNEIHEISARGVSAHILMYQILTDGDFLIPLSDIINSLMFKEKTPIFNIIPRDKKTGKHGIINIEKDII 468
211956312 389 TYFSNTVLLsGNDKIHEISSRGISAHILIYQALMKHDISIPLTDIVNSLIGRNKQPIYEIIPRDKKTGKHGIIDIEKDII 468
41057454  480 TH 481
9634772   471 FH 472
12085015  469 TH 470
9628963   469 TH 470
38229195  469 TH 470
40556067  471 FH 472
41057081  471 TH 472
62637418  469 TH 470
157939654 469 TH 470
211956312 469 TH 470
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap