Conserved Protein Domain Family
PHA02993

?
PHA02993: PHA02993 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165295
View PSSM: PHA02993
Aligned: 22 rows
Threshold Bit Score: 233.776
Threshold Setting Gi: 66275851
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956309   1 MDINKLEDIINLNPFKNMKKIKINLDDNCLLGNRCFVKVGNVRYIPTNSIETSESIMIRGHKFTLLELLYSPFHFQQSQH 80 
148912906   1 MNVNKLDEIIKLSPFRNMDKIKINKDDNCLLGNRCFVKMDTVKHFPTNSVATSDSVIIKGYRFTLTELLYSPFHFQQPQC 80 
38229192    1 MNVTVLSDLMLLNPFKNMNKVIINLNDNCVLGNRCFVKLDKVRCIPSNSVETSKPILIKGCKFTLPELLYSPFHFRRPQV 80 
40556070    1 MDVSRLDQLLSMHPFSDMDNVIINEKENCILGNRCFVKISEVYNMPI-CFNTEQCVSMDRLKFSLVEILYSPFYYKQLQY 79 
15150468    1 MNVNKLDEIIKLSPFRNMDKIKINKDDNCLLGNRCFVKMDTVKHFPTNSVATSDSVIIKGYRFTLTELLYSPFHFQQPQC 80 
21492482    1 MNVNKLDEIIKLSPFRNMDKIKINKDDNCLLGNRCFVKMDTVKHFPTNSVTTSDSVIIKGYRFTLTELLYSPFHFQQPQC 80 
9628957     1 MNVTRLEQVIGLQPFHDMDRVKINRKENCILGNRCFVKLAEVFHMPRCSVPTSASLCANNHSFTLHELLYSPFHYKQPQY 80 
12085012    1 MNISGLSDLISLNPFKNMNKIKINLNDNCVLGNRCFVKVDKVRFIPYNSVETSKPVMIRGCTFTLPELLYSPFHFQQPQI 80 
9633660     1 MNVSTLDDILKLNPFKHMNRIKINREEKCLLGSTSFIKIDKVKHIPGNAVNVSKSIHVRGQDFTLSELLYSPLYFQQARG 80 
9633834     1 MNVSTLDDILKLNPFKHMNRIKINTEEKCLLGSTSFIKIDKVKHIPNNAVDVSKSIRVRGQDFTLSELLYSPLYFQQARG 80 
211956309  81 QYILPGFILTCIEKAKRNKNICKYCITDRGdGRDSLSINIFIQTIYTSVYIIIGLRIKYFWSSNFEIE 148
148912906  81 QYLLPSFVLKCIDEATKNKTICKYCIINK--DDNSLNINIFVPTFDLK-YLIIGLRIKHFWSSKFQIE 145
38229192   81 QYLMPGFVLYCIEEAKKNKSESRYCIVDNDiETDELKINIFVPTFLKSVYVIIGLRVKHFWSSKFKIE 148
40556070   80 QYLMPQFIFKCINEANNKKKTCSYCFTKKK-EHNSLNIDIFIPTTNPRYYIVIGLRIKDYWRQSFKVN 146
15150468   81 QYLLPSFVLKCIDEATKNKTICKYCIINK--DDNSLNINIFVPTFDLK-YLIIGLRIKHFWSSKFQIE 145
21492482   81 QYLLPSFVLKCIDEATKNKTICKYCIINK--DDNSLNINIFVPTFDLK-YLIIGLRIKHFWSSKFQIE 145
9628957    81 QYLLPSFVFTCIELARKNNQTCYYCKADRAnEEGSLNLNIFVPTLARSMYVVIGIRIKDYWVEAFEIV 148
12085012   81 QYLMPSFVLYCIEEANKNKSTSKYCIIDKNtETDELKINIFVPTFLKSVYVIIGLRIKHFWSSKFKIE 148
9633660    81 QCIMPHFVLKCIDEAKKNRMVCKYCTVTKSsDPQGLNANIFIPTKTESTYIIIGIRIKSYWSVTFRVE 148
9633834    81 QCIMPHFVIKCIDEAKKNRMVCKYCTVTKSsDPQGLNANIFIPTKTESIYIIVGIRIKSYWSVTFRVE 148
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap