Conserved Protein Domain Family
PHA02988

?
PHA02988: PHA02988 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165291
View PSSM: PHA02988
Aligned: 10 rows
Threshold Bit Score: 332.477
Threshold Setting Gi: 40556212
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148913020  20 QNIINQSYINPIRCIKSDDIy--QSYTSVVIKENNQNYIYKGIFNNKEVIVRTFKKSHTSYKILMDISNNEIKNLRRIDS 97 
211956429  28 ESYIDRKCINKIKYINSEDI---DKENILVIKENEQNIIQTGIFNDKKVIIRSFKKFQKGHKVLSDICENEIENMKKIDA 104
62637535   28 ESYIDRKCINKIKYINSEDI---DKENIFVIKENEQNIIQTGIFNDKKVIIRSFKKFQKGHKVLSDICENEIENMKKIDA 104
40556212    1 --MSTEFQLSDIKNIEVKDI---EDY--VSVYTGDCYSIYSGKYGGESITIKLLGHDKNDIKKII----KEINMLRCFKY 69 
21492593   20 QNIINQSYINPIRCIKSDDVy--QSYTSVVIKENDQNYIHKCIFNNKEVIVRTFKKSHTSHKILMDISNNEIKNLRRIDS 97 
18640226   18 RLFLDRKYVNNAICIESTSI---NNDNMIIIKENEQLSIYRGEFNNKDVLIKTFKKFHIGHKVLIDITENEIKNMKKIDS 94 
15150582   20 QNIINQSYINPIRCIKSDDIy--QSYTSVVIKENDQNYIHKGIFNNKEVIVRTFKKSHTSHKILMDISNNEIKNLRRIDS 97 
9633782     1 -----MSSYYSIKRVSPHLI---DRYAFTLIKESDQCFIHKGAFNNTLVVVRTFKKFHKGCKAILELTENEIRGVKRVDR 72 
9633952     1 ------MSSYSIKRVNPHLI---DKYTFTLIKESDQCFIHKGVFNNTLVVIRTFKKFHKGCKAILELTENEIHNVKSVDR 71 
9634873     1 MDIITNTTMFDIQFNDIPNIpyvDIEKPLLVYSCDSYRLYNAKYDNNPVSLKTFTCPSKNS---IRQFIKELDLLRSLQS 77 
148913020  98 N-NILKIYAFYIEMCDGLPRISLILEYCKRGYLKNVIRKERDLTFKTKLNMAIDCSVGLYNVYKYTNyKP--YGCISSVS 174
211956429 105 Y-NILKIYGFFIDIVDELPRVSLLIEFCDRGYLREVLNYEQSLSLQTRVDMAIDCCVSLYNLYKYIN-RP--YKHITSVN 180
62637535  105 Y-NILKIYGFFIDIIDELPRVSLLLEFCDRGYLREVLNYEQSLSLQTRVDMAIDCCMSLYNLYKYIN-RP--YKHITSVN 180
40556212   70 ApNVIRLLGYIYD--DSLPYGIVVEDICLT--LREYLDNNKNLSYYVKASIMLDAVKGLEALHTKDG-TPilHQNLTSDS 144
21492593   98 N-NILKIYAFYIEMCDGLPRLSLVLEYCKRGYLKNVIRKERDLTFKTKLDMAIDCSVGLYNVYKYTNnKP--YGCISSVS 174
18640226   95 N-NILRIYAFYVEMVDDLPRLSLILEYCKRGYLKNVLMNEKQLLFKTRLDMAIDCCNGLYNLYKYTN-KP--YGYISSNV 170
15150582   98 N-NILKIYAFYIEMCDGLPRLSLILEYCKRGYLKNVIRKERDLTFKTKLDMAIDCSVGLYNVYKYTNnKP--YGCISSVS 174
9633782    73 F-NLLKVYGFFVDVVDALPRVSIILEYCTKGYLREVLYKEQDLSFKTRLDMALDCCTGLASVCKYTK-KP--YEHLSSVN 148
9633952    72 F-NLLKVYGFFVDVIDDLPRVSIILEYCTKGYLREVLSKERDLQFKTRLDMALDCCTGLVNVYKYTK-KP--YEHLSSVN 147
9634873    78 SeHVIKLYGYILDISVPLCSLVVENNYLT---LRNFLDMEKDIDYAKKTRIIIDAAKGLNAMHTSYS-TPilHKNLTSES 153
148913020 175 FLVEENYKVKIICHGLEKILANPPFKNINAIVYQSHKMLSNVFNERTIDDDMYSFGVVLWEIFSGKIPFKNLTTKEIYDL 254
211956429 181 FLVKENYKIKLVGHGLEKLLSSPAFKNVNDVVYKSPKLLNNIFEPLLIEDDIYSLGIVLWEVFTGNIPFEGLSTKEIYDL 260
62637535  181 FLVKENYKIKLIGHGLEKLLSSPAFKNINDVVYKSPKLLNNIFETLSIEDDIYSLGIVLWEIFTGNIPFDGLNTKEIYDL 260
40556212  145 FYMTKNNILKIGIGSRYK-----PSNKVNFMAYFDYNILTDIFSEYTIISEIYSLGVVLWEILTGKIPFENMDYTSIYNM 219
21492593  175 FLVEENYKVKIICHGLEKILSNPPFKNINAIVYQSHKMLSNVFNERTIDDDIYSFGVVLWEIFSGKIPFKNLTTKEIYDL 254
18640226  171 FLVEENYKVKIIAHGLEKVMSSPSFKDINTSVYLSPKLINNIFSKHNLEDDVYSLGILLWEIFTGDVPYKNLSIKELFKN 250
15150582  175 FLVEENYKVKIICHGLEKILANPPFKNINAIVYQSHKMLSNVFNERTMDDDMYSFGVVLWEIFSGKIPFKNLTTKEIYDL 254
9633782   149 FLVDGDYTTKILCHGLEKTLSVPPFKNVNMLVYRPRRILLDIFSKYTEKDDMYGLGVVLWEIFTGHVPFNNATTADIYDA 228
9633952   148 FLVDEDYTTKILCHGLEKTLSVPPFKNINMLAYRPRRILLDIFSKYTEKDDVYSLGVVLWEIFTGCVPFDHATSTDIYDA 227
9634873   154 FYMTNNGVLKIGSGAYYNI-----YKRVNFMAYFDYDMLKDIFSNYTIKSEIYRFGIVIWEIITRKIPFENMDYQGIYNM 228
148913020 255 IINKNGQLKLP-ETPHLIKYTVEKCTSHTS-KRPNIKEILYNFSLYKFYN 302
211956429 261 ILLNNYSFKVD-NCPQIINCVVERCTDHDAtKRPTVKEILYNLSLYKFYY 309
62637535  261 ILLNNYSFKVD-NCPQIINCVIERCTNHDAiKRPTVKEILYNLSLYKFYY 309
40556212  220 LIKDNVSEPLPlDAPLELQSIITACRHKEYsRRPNTTSMRIFLHQYTINI 269
21492593  255 IINKNGQLKLP-ETPHLIKYTVEKCTSHTS-KRPSIKEILYNFSLYKFYN 302
18640226  251 I--NINELRLEiSGHTFIKNIVNHCLVHDEvKRPNLKDILYNLSMYKIYF 298
15150582  255 IINKNGQLKLP-ETPHLIKYTVEKCTSHTS-KRPNIKEILYNFSLYKFYN 302
9633782   229 VVNKNDELKIDtKCPRYIKNVVDRCTSHQEdTRPTLNEVLHKISMYRCVM 278
9633952   228 VVNKNNELKIDtKCPRYIKNIVDRCTSHQEdIRPTVHEVLHKISIYRCIM 277
9634873   229 LIKENKGEYMPlDCPLELQCIVIACRNTNSiFRPSISAIIDFLETFYSNI 278
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap