Conserved Protein Domain Family
PHA02987

?
PHA02987: PHA02987 
Ig domain OX-2-like protein; Provisional
Statistics
?
PSSM-Id: 165290
View PSSM: PHA02987
Aligned: 10 rows
Threshold Bit Score: 156.563
Threshold Setting Gi: 38229299
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633948     1 MNILSILALLSTVAYAYAIYCTNTTTVYEHVN-VTISCNNTgsrdndssNRLTFHLITWKKDNKtTVAGYGPSGPAIGN- 78 
9633777     1 MRVLSILALLSTVAYAYSVRCTNTTTVAEHVN-VTISCNKTs------sSSSLFHLITWKKNNEtTIAGYGPSGATIKD- 72 
12085124    2 klLLLFVSVLTLFNYLQSTSCFVKSFINSLD--IKITCTKT--------SSFNTIIITWKKDNK-FIAGYGICGPVISEk 70 
15150577    5 NNIFKLIWIGNYINVILSASCISKIYSSFKENtVKISCSKT--------SKFNSIIITWKKNNE-TIATYGPHGSYVVDd 75 
21492588    5 NNIFKLIWIGNYINVILSASCISKIYSSFKENtVKISCNKT--------SKFNSIIITWKKNNE-TIATYGPHGSYVVDd 75 
38229299    3 iiILLCINITVLFKHLQSTDCFVEYQNSLD---AKITCTKI--------SHSNTILITWKKDNK-FIAAYGICGPVILNk 70 
62637530    2 alFFKLVNLFIIIKYVHAIHCVHNITTKPYKD-VYLSCNKT--------ISFDSILITWKKNNQ-SILYYGTMGPIVVDk 71 
157939765   2 klLLLFVSVLTLFNYLQSTSCFVKSFINSLD--IKITCTKT--------SSFNTIIITWKKDNK-FIAGYGICGPVISEk 70 
148913015   5 NNIFRLIWIGNYINVILSASCISKIYSSFKENtVKIGCNKT--------SKFNSIIITWKKNNE-TIATYGPHGSYVVDd 75 
211956424   2 alFFKLVNLFIIIKYVHAIHCVHNITTKPYKD-VYLSCNKT--------IPFDSILITWKKNNQ-SILYYGTMGPIVVDk 71 
9633948    79 -KNKIEYLSTGYNTSTILIKNVTVKDSGLYYCIFETIMPLSSEEGVVWVNVTTPSATTTSLQqpqplalrt----tsgrs 153
9633777    73 -ASKIEYLSTGYNTSTILIKNVSAEDSGLYYCIFNSFSTEPSEEGTVRVNVTTSSATTTLQQpqpqalrttrgrstnrst 151
12085124   71 fKGKILYVSKSFNESTILIKNVNLFDRGCYTCVFNFLVSKNNEKGVVCLT------------------------------ 120
15150577   76 yKNKIEYISKSFNYSTIVIKNATIQDNSCYTCIFNILLSE-NDKGTLCLNTTNDEYINNLIP------------------ 136
21492588   76 yKNKIEYISKSFNYSTIIIKNATIKDNYCYTCIFNILLSK-NDKGTLCLNTTNDEYINNLIP------------------ 136
38229299   71 fKGKIQYLSKSFNESTILVKNVSLL-GGCYVCTFNFLPSKNNEKGVVCLT------------------------------ 119
62637530   72 fKTKIKYMSDTFNKSIILIKNVSESDNGCYECTFNTLNIKFNDKGVICVNVSDEVYTDD--------------------- 130
157939765  71 fKGKILYVSKSFNESTILIKNVNLFDRGCYTCVFNFLVSKNNEKGVVCLT------------------------------ 120
148913015  76 yKNKIEYISKSFNYSTIIIKNATIKDNSCYTCIFNILLSE-NDKGTLCLNTTNDEYIKNLIP------------------ 136
211956424  72 fKTKIKYMSNTFNKSIILIKNVSESDNGCYECTFNTLNIKFNDKGVICVNVSDEVYTAD--------------------- 130
9633948   154 tstYVTRTSTGQIGDGFLMVETRRRECSSSSSSSSRLTSSLGSRNLSRLFKVILIIKMIF 213
9633777   152 srhVSRTSTHHVGDGSLTVETRQYKYSSSSSSSSSSWTSSAGSRNVPSLFKLIFVIKMIF 211
12085124      ------------------------------------------------------------    
15150577  137 ---IKINENNNHIKNNIIVDDYGTTESLFSLY-------GTLCLCFWIYMYYVDTVRFFL 186
21492588  137 ---IKINEN------NIIVDDSVVQNHCFLYIVRYVFVFGFICTTLILYDFFL------- 180
38229299      ------------------------------------------------------------    
62637530  131 ---ITINSNSFTTKGNNILTTTLYDDPSSIQYINYTNNGNRNGISIYQYLKVFLALLMLL 187
157939765     ------------------------------------------------------------    
148913015 137 ---IKINENNNHIKNNIIVTNSVLQNHCFLYMVRYVFVFGFICTTLTLYYFFL------- 186
211956424 131 ---ITIDSNSFTTKGNNILTTTLYEYPSSIQYINYTNNSNRNGISIYQYLKVFLALLMLL 187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap