Conserved Protein Domain Family
PHA02985

?
PHA02985: PHA02985 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165288
View PSSM: PHA02985
Aligned: 16 rows
Threshold Bit Score: 280.038
Threshold Setting Gi: 20178535
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
18640210    4 EKTKVFKMIPFFNGMKIKNRVLELANMNVTNYYDSNHSDIILSEIEHCINEKIYTSNMITIKHYDQHtirKKTIESVSCN 83 
9633936     1 MKNNIYKIIPFFNPLDIKNQVTNLYDAGSLSYRHPEHIAFILTEVEHRLNERVYTKEPIQIMRFDKH---SVYKQEAPSP 77 
9633762     1 MKNNVYKIIPFFNPLDIKRQVTNLYDAGTLSYRHPEHIAFILTEVEHRLNERVYTKEPIQIVRFDKH---SVYKQETPSP 77 
12085110    1 -MNSTFRVIPFFNFSDIKTYVHYLANNGKKNYYGPCHARKITLEIKKHIDDEITVNNLINIHVYKLKtnkKKYYFINDFI 79 
21492579    1 MKNKIFMSIPFFDIIKIKTQVLDLLCMNITKYYNEEHVNIIVKEIEQYINEKVFVKNLISIRCFNKEg-cDKNVQNFNTS 79 
17975062    1 MHYTNMEIFPVFGISKISNFI---ANNDCRYYIDVEHQKIISDEINRQMDETVLLTNILSVEVVNG----NEMYHLIPHR 73 
15150566    1 MKNKIFRSIPFFDIIKIKTQVLDLLCMNITKYYNEEHVNIIVKEIEQYINEKVFVKNLISIRCFNKEg-cDKNRQNFNTS 79 
38229290    1 --MSFTKIIPFFNFSDIKTYVHYLANNGKKDYYGPLHAKKITLEIKKYIDDEITVNNLISIHVYKLKt-kKNDCINNNFI 77 
148913005   1 MKNKIFMSIPFFDIIKIKTQVLDLLSMNITKYYNEEHVNIIVKEIEQYINEKVFVKNLISIRCFNKKg-cDKNEQNFNTS 79 
157939751   1 -MNSTFRVIPFFNFSDIKTYVHYLANNGKKNYYGPCHARKITLEIKKHIDDEITVNNLINIHVYKLKtnkKKYYFINDFI 79 
18640210   84 SVKAFVCIQSAKKGGMLIVFNKITKYKRIIHPNTNCIVLLNSLAEYSISNVNRGTVTIITLDIDIPSMRIIDKKIKNIHY 163
9633936    78 LSKVIICLQRAKKGGNIVVYDTVMSQKKVITLNVNSMVLLSPLIEYTVSNVTKGQLIAIALDIDIPSIRIIYTSIERIRY 157
9633762    78 LSKVIICLQCAKKGGNIVISGTIMSQKKVITLNVNSMILLSPLTEYTVSNVTKGQLIAITLDVDIPSIRIIYTSVERIHY 157
12085110   80 ISKVIICIQQAKKGGCIII--NELNNCKQFKLKDDKIIILSPLSQYYVSKVLKGKLIIIILEMYIPSMQNLLIKNKNVNF 157
21492579   80 FSKALICIKSAKKGGVMVIFNKATKNKKVVYPSSNHIILLNPLSYYTISKVNRGSVIMMVLDIDIPSMRIMYKSINNVKY 159
17975062   74 LSTIILCISSV--GGCVISIDNDVNDKNILTFPINHAVIISPLSKCVV--VSKGPTTTLVVKADIPSKRLVTSFTNDILY 149
15150566   80 FSKALICIKSAKKGGVMVIFNKATKNKKVVYPSSNHIILLNPLSYYTISQVNRGSVIMMVLDIDIPSMRIMYKSINNVKY 159
38229290   78 ISKAIVCVQQAKRGGYIII--NELNTSKRFKLKDDKIIILSPLSRYHVSKVFRGRLVIIVLEMFIPSMQILLINNKNVKF 155
148913005  80 FSKALICIKSAKKGGVMVIFNKATKNKKVVYTSSNHIILLNPLSYYTISQVNRGSVIMMVLDIDIPSMRIMYKSINNVKY 159
157939751  80 ISKVIICIQQAKKGGCIII--NELNNRKQFKLKDDKIIILSPLSRYYVSKVLKGKLIIIILEMYIPSMQNLLIKNKNVNF 157
18640210  164 SNSLTLLNPIKCNEIVFVIKQLLDIHSlSVICEQILINNEWYMIIRCGTNKFYLPSVCLGKIL-LNFNYVYDNFDKEKIA 242
9633936   158 GSTLIVLSPFGKQDIVFFVKQLLDEHF-KVVCEQILINKEWYTIIKTDQKNLYITSRCFGKAL-LHFNFVYDQFDKSTIE 235
9633762   158 GSTLLVLSPFAKQDVVFFVKQLLDEDY-KVVCEQILINKEWYTIIKTEQKNLYIQSRCFGKAL-LHFNFVYDHFDTSTIE 235
12085110  158 ANNLKVLYPI-NGDIIFLIKQISYLN--KIICTQILINQQWYCIVNAGSNKLLLPSVCIGKSIsLDYNEVYTNVDFVIKN 234
21492579  160 SNVLSLLFPFFKNEFVFALKQLIDINNnQVLCEQIVINREYYTVISTNLKKFYIPSICFGKKI-IDFNYGYDDFNEDIIN 238
17975062  150 VNNLSLINYLPLS--VFIIRRVTDYLD-RHICDQIFANNKWYSIITIDDKQYPIPSNCIGMSS---AKYINSSIEQDILI 223
15150566  160 SNVLALLCPFFKNEFVFALKQLIDINNnQVLCEQIVINREYYTVISTNLKKFYIPSICFGKKI-IDFNYGYDDFNEDIIN 238
38229290  156 TNNIKLFYPV-KGDQIFIIKQITNVLN-KVVCTQVLINQNWYSVVNAGCSKLLLPSICFGRSIsVNCDNVDVKSVINNIG 233
148913005 160 SNVLALLCPFFKNEFVFALKQLIDINNnQVLCEQIVINREYYTVISTNLKKFYIPSICFGKKI-IDFNYGYDDFNEDIIN 238
157939751 158 ANNLKVLYPI-NGDIIFLIKQISYLN--KIICTQILINQQWYCIVNAGSNKLLLPSVCIGKSIsLDYNEVHTNIDFVIKN 234
18640210  243 AIINNNTPFDLIYPQKSIYRTSIVYEKILYGKICIN 278
9633936   236 YIINTHIPFNLVSPQKKIYTSRVMYEKALYGKLTVE 271
9633762   236 YIINTPIPFSMVSPQKKIYTSRVMYEKALYGKLTVV 271
12085110  235 ITIFDNIPFNYIFPQKVIYNNIELNEKVIYCKINHS 270
21492579  239 KIINSDTPFDFISPQKSIIDASLVYEKVIYGKINV- 273
17975062  224 HVCNLEHPFDSVYKKMQSYNSLPIKEQILYGRIDNI 259
15150566  239 KIINSDTPFDFISPQKSIIDASLVYEKVIYGKINV- 273
38229290  234 IIFN-SVPFNYILPQKIIYNNFEFSEKVLYCKLC-- 266
148913005 239 KIINSDTPFDFISPEKSIIDASLVYEKVIYGKINV- 273
157939751 235 SNIFDNIPFNYIFPQKVIYNNIELNEKVIYCKINHS 270
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap