Conserved Protein Domain Family
PHA02984

?
PHA02984: PHA02984 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165287
View PSSM: PHA02984
Aligned: 11 rows
Threshold Bit Score: 332.873
Threshold Setting Gi: 62637512
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
148913003   1 MINRINLSYGIVKYIKALLLKENISESDKSIIKTIINESIYPHN-YVYNILDFNSLTINFNTCEER-NIIDfkDVNIKPQ 78 
211956406   1 MKYINNVPNYIIGYVTKLLTKEYISQHDENKIKKIINETINEEH-SALKILSIYSLTVNISDINNSfNLIE--DISYKRC 77 
157939749   2 CNKASFIPKWVIKFVKSILLKDFVSKSDEKILADIINNFTNIDH-SMLNIININSVHVIINNDESSfNLSN--VDCLKNS 78 
62637512    1 MKYINNVPNYIISYVTKLLTKEYISQHDENKIKKIINETINEEH-SALKILSIYSLTVNISDINNSfNLIE--DISYKRC 77 
38229288    2 YNKASFIPKWVIKFVKSILLKDFVSKSDEKILADIIINSTNVNY-STLNIININSVNVVVNNNENIfNLLD--VNCLKRS 78 
15150564    1 MINRINLSYGIVKYIKALLLKENISESDKSIIKTIINESIYPHN-YVYNILDFNSLTINFNTCEER-NIIDfkDVNIKPQ 78 
18640208   20 MIKCINLSNCVIKCIKNIISKDTVSSMDEYLLKTIIDEYIDNNYvSVSSILSINSLTVNCDNQVD--NIINlkDVDIKPH 97 
21492577    1 MINRINLSYGIVKYIKALLLKENISESDKSIIKTIINESIYPHN-YVYNILDFNSLTINFNTCEER-NIIDfkDVNIKPQ 78 
12085108    2 CNKASFIPKWVIKFVKSILLKDFVSKSDEKILADIINNFTNIDH-SMLNIININSVHVIINNDESSfNLSN--VDCLKNS 78 
9633760     1 MLKRVSVTSHVVDYMKKLSQDELLTDDEEELVKTIINEFTQEN---AVEILNITSVVVNLPNLNEY-NVIDfkDAVIKPR 76 
9633934     1 MLKRVSVTSHVIEYMKKLSQNELLTDDEEELVKTIINEFTQEN---VVEILNITSVTVNLTNLNGY-SVIDfkDVNIKPQ 76 
148913003  79 RCISYYKDYILESSEYMFIVCLKGETIIKCYNNNVISSNKVQKGEAFTLNIKTRYITITKNRDLHLAIITYTTIYPLIYY 158
211956406  78 PTINYYNGYTLQSNDYIYVLCLQGKACIEVFNKESLCTYDISKGDIFTMNYNSNHLVKTNDKNLRLAIVMYTSNFPFIHY 157
157939749  79 THVVKNDNCIIQSNEYMFVICLNGSISIECLKKGLKITSTIYKGEAFSIHSTLKHVTTTKDKNLHLAVIKYDVNCPFIHF 158
62637512   78 PTINYYNGYTLQSNDYIYVLCLQGKACIEVFNKESLCTYNISKGDIFTMNYNSNHLVKTNDKNLRLAIIMYTSNFPFIHY 157
38229288   79 THVINNDNHVIQSNEYMFIICLNGSISIKCFKKGLKITNTVYKGEAFSIHSTLRHVTTTKDKNLHLAVIKYDVNCPFIHF 158
15150564   79 RFISYYKDYILESSEYMFIVCLKGETIIKCYNNNVISSNKVQKGEAFTLNIKTRYSTITKNRDLHLAIITYTTIYPLIYY 158
18640208   98 RLIDHHNDYTLESNEYIFALCLKGKTTVKCNTSTKSISNAIKRGEAFVLNLKTKYTTVTHTKQLHLAVIMYRTTCPFVYY 177
21492577   79 RFISYYKDYILESSEYMFIVCLKGETIIKCYNNNVISSNKVQKGEAFTLNIKTRYSTITKNRDLHLAIITYTTIYPLIYY 158
12085108   79 THVVKNDNCIIQSNEYMFVICLNGSISIECLKKGLKITSTIYKGEAFSIHSTLKHVTTTKDKNLHLAVIKYDVNCPFIHF 158
9633760    77 QLIEHYGKYTFESNEYMFVLCINGAGRMEGSNDDSKQTYSIKKGDAVNVNLKTKYRILTDDKNLQLIVVTYTSRCPFVHY 156
9633934    77 RIIEHYGNYMFESNEYAFVLCVGGTSRMESENSDSKQAYSIKKGDAVNVNLKTKYRILTNDKNLQLVVLTYVSRCPFVHY 156
148913003 159 KNIVFSKDSSLYNIFSGYKFALFRISSD-DDKVLEDIIILNGRYYYSNSMEKVNIINIKTLLDKYNIKINSftqIDYIPK 237
211956406 158 KNLVFSEDSFIYNTFSGYKFALVRLFDE-SDTLLEDIILANGRFYNSDFTKKNKIINIKNLLTKYDINNFN---IDYIPK 233
157939749 159 KNTVYSEDSFVYNLFSGYNFALFRLYDN-YNNKVEDILITNNNVYNEN-MRIEKVLGIKSLLYKHSILQKIy--LDYIPK 234
62637512  158 KNLVFSEDSFIYNTFSGYKFALIRLFDE-SDTLLEDIILANGRFYTSDLTKKNKIINIKNLLTKYDINNFN---IDYIPK 233
38229288  159 KNTVYSEDSFVYNLFSGYNFALFRLYDS-YDNKVEDVLITHDNIYNEN-MKQKNVLGIKSLLCEHSIPQKIs--LDCIPK 234
15150564  159 KNIVFSKDSSLYNIFSGYKFALFRISSD-DDKVLEDIIILNGRYYYSNSMEKVNIINIKTLLDKYNIKINSftqIDYIPK 237
18640208  178 RNIVFSEDNCLYDIFSGYRFALFRLFDT-NDTLLEDVIILNGTYYNSLSMKKSDIINIKTLLRKYNIQLNNt-sIDYVPR 255
21492577  159 KNIVFSKDSSLYNIFSGYKFALFRISSN-DDKVLEDIIILNGRYYYSNSMEKVNIINIKTLLDKYNIKINSftqIDYIPK 237
12085108  159 KNTVYSEDSFVYNLFSGYNFALFRLYDN-YNNKVEDILITNNNVYNEN-MRIEKVLGIKSLLYKHSILQKIy--LDYIPK 234
9633760   157 KNVVFSEDSSVFDAFVGCRFALFRLVSDySEEILEDLLILNGVYYHSCSMKKANIISLKSIVTKYGLCPIE---LDYVPN 233
9633934   157 KNVVFSEDSIVFDAFVGCRFALFRLVSDyDGEILEDILILNGTYYHSCSMKKANIISLKSILTKYSLYPIE---LDYVPN 233
148913003 238 S-SHKACVEALELSLDDVTVRQIYDGTSFKAVCSKSGIKYKIVILYCVLCYN 288
211956406 234 NdSINTSLEIVELSLDNNTIKGISDGTYTKNIYSSDGIKYKLLISYGVICNG 285
157939749 235 S-NVKYISEIVDLSLDKETLNSVFNFVNSKSVYSNSGNKYKYFLTYGVLCYE 285
62637512  234 NdSINTSLEIVELSLDNNTIKGISDGTYTKNIYSSDGIKYKLLISYGVICNN 285
38229288  235 S-NVKYGTEIAELSLDNETLNNVFNFITSKDVYSNSGNRYKYLLTYGVLCYE 285
15150564  238 S-SHKACVEALELSLDDVTVRQIYDGTSFKDVCSISGIKYKIVISYCVLCYN 288
18640208  256 N-YHKDSKEAVELSLDNNTVMHISDGTYTRDIYSLLGTKYKLLFAYGVICYN 306
21492577  238 S-SHKACVEALELSLDDVTVRQIYDGTSFKDVCSISGIKYKIVILYCVLCYN 288
12085108  235 S-NVKYISEIVDLSLDKETLNSVFNFVNSKSVYSNSGNKYKYFLTYGVLCYE 285
9633760   234 S-GHPTELELLELSLDEDTVQAISNGTCYKETCSLSGIRYKLFIVYGVTCYS 284
9633934   234 S-GHPTELELLELSLGEETVQAISNSTNYRETCSLSGIKYKLFVVYGVTCYS 284
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap