Conserved Protein Domain Family
PHA02980

?
PHA02980: PHA02980 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165284
View PSSM: PHA02980
Aligned: 3 rows
Threshold Bit Score: 161.106
Threshold Setting Gi: 40555993
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556250   1 MINFRLIIACNVGCILSMLLSYNSFLKSEFYNYTKSRKHLIFPPLGVIFSLYICGYIFLFKGISVIHTRyRRDCNELAAY 80 
9634707    3 LFEYICDHSYSLISLTLWLIVVKIIEKYSFYNYIGYNKYHVVKEYYFRCVLSAISYACMGHAMYLMTSG-EKISRHIIIF 81 
40555993   5 IFEYLCDSSYTIIAILSLLIILENIEQGDFFDYVENNITFMIPKYYTRMFLYIISYGFMGHGMYLISTE-NYDSAKVIFT 83 
40556250  81 YILQMSINLSFFIVFYELHMVRLTIAMSTFSICIIVYFIYLWRFETDINDKYVLFYLVTSYINSLLSYYIMRSKLNNDYK 160
9634707   82 YFLQLFLDMSWFLVFYIMSMLRTSAIISALNVLLSVYNFLTWNSMSAVIGACISPFMVVSSLHLLLNYNVISLSKKSEKS 161
40555993  84 HLLQLSVGLSWFIVFYNMNILRLSMLISSVHLFLSLYNSYVWYNIGSYISLFNVPCISMSIINLLLNFRTIQTYHLAKEE 163
40556250 161 K 161
9634707  162 Q 162
40555993     -    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap