Conserved Protein Domain Family
PHA02979

?
PHA02979: PHA02979 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165283
View PSSM: PHA02979
Aligned: 2 rows
Threshold Bit Score: 190.936
Threshold Setting Gi: 40555992
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634706   15 MNYHMISFIDDIDLYTECSRITDFY-RLINNTKVINIFVSETLTNILSQYLLNNEYLAHVMLVMDINDYTLEVgNYSNFI 93 
40555992   1 MKTSTFSLPCNSDLYVECEVLSSLYrRVLNEEKIVDVFISDTIRKNIQPFLSDDEILTNIKLISDASEYSFKT-NSSSVL 79 
9634706   94 ILCIDSEDCGLLLHNDGKCiVLYPNNMVRFVSYPyNSIDIKNSIATDSKYNIIVFFISRT 153
40555992  80 VICICSDKFGLLINNDNGY-PLRKNNIVKFSSCN-GKMRITADMSKSKEYSIFVFFTETK 137
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap