Conserved Protein Domain Family
PHA02978

?
PHA02978: PHA02978 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165282
View PSSM: PHA02978
Aligned: 2 rows
Threshold Bit Score: 208.973
Threshold Setting Gi: 9634705
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634705    1 MDINIKELEHDKDVINYINKIKDLCSCHTMFPNSINFIMRKLLNLrDTSNIIGMFRLNKINNCIHHIKSGDEIIIYGSYI 80 
40555991  12 MDIIVEKMEYNQEIINYIDSIKYLCSCRVQFPASTNYTMGKLLGL-DKIEIIGMFRMNQVNNSVHYIRSKDKLIVYFSYA 90 
9634705   81 DSSGLTIRVSTSTSTKFTYIDMLSIIAIKCNTDYLIECITNNDFEVVIFGIRKII 135
40555991  91 GPDGISIQVSTPKCTKVIQAETYSILAIKCNCDYVIQCISESDFEVVIFGLRKYE 145
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap