Conserved Protein Domain Family
PHA02977

?
PHA02977: PHA02977 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165281
View PSSM: PHA02977
Aligned: 2 rows
Threshold Bit Score: 410.134
Threshold Setting Gi: 9634695
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40555981   1 MAGILCKLSHILANEKNSRKDTILMGLDVKVPWDYSNWASVNFYDVRLDTDVTDYNNVTIKYMTGCDIFPHITLGIANMD 80 
9634695    2 ATTIQKELEKIVVKEKQNKKDAILMGLEVEVPWDYCNWASISFYDIRLEKGISDLESIAVKYMTGCDIPPHVTLGIANKD 81 
40555981  81 QCDRFENFKKQITDQDLQTISIVCKEEMCFPQSNASKQLGAKGCAVVMKLEVSDELRALRNVLLNAVPCPKDVFGDITVD 160
9634695   82 QESNFKRFKELTKNIDLTSLSFTCKEVICFPQSRASKELGANGRAVVMKLEASDDVKALRNVLFNVVPTPREIFGSVLSD 161
40555981 161 NPWNPHITVGYVKEDDVENKKRLMECMSKFRGQEIQVLGWY 201
9634695  162 PVWCPHVTIGYVSADDEDNKNRFIELAEAFRGSKIKVTGWY 202
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap