Conserved Protein Domain Family
PHA02976

?
PHA02976: PHA02976 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165280
View PSSM: PHA02976
Aligned: 2 rows
Threshold Bit Score: 286.929
Threshold Setting Gi: 40555951
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634685    1 MVILREIS-SEIKSCFNEVTPITNSMVFMQVNGTRPTPESILKAFDYDTKCKFMTSCIIFNIFIGCLHPDTEYVSGCTQY 79 
40555951   1 MVIITNITdPEAASCLRDVTTYGSGVSLLQVNGTVTTPRDILKAYDDDTRCKFLRSCIIFTMYIGCFPDSIEYSSGCFTY 80 
9634685   80 TTRDEILNMVDG--EGKFYVEKL-SPMSEFCLAMAPLVYNEDLKSNMTDTNKCKNVNKEEMFKPtydnYRDYRDyrsyep 156
40555951  81 ITRNEFLNMTKSsyNEEFYIPLLnTTLDRFCMIIAPRVITSQDIEHLNEDEPCKYVRDLGMTKP----YNDGRD------ 150
9634685  157 enlVKCVNPNDVYETKKILLY 177
40555951 151 ---INCLNITDIRYIKNSIIY 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap