Conserved Protein Domain Family
PHA02974

?
PHA02974: PHA02974 
putative IMV membrane protein; Provisional
Statistics
?
PSSM-Id: 165278
View PSSM: PHA02974
Aligned: 2 rows
Threshold Bit Score: 103.063
Threshold Setting Gi: 9634755
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634755   1 MEIARETLITIGLTILVVLLIITGFSLVLRLIPGVYSSVSRSSFTAGRILRFMEIFSTIMFIPGIIILYAAYIRKIKMKN 80 
40556050  1 MELTRETLIFVGITVLVVVMIISGFSLILRLIPGVYSSVIRSSFVGGKILRFMEVFSTVMFIPSLVILYTAYIRKSKVKN 80 
9634755  81 N 81 
40556050 81 N 81 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap