Conserved Protein Domain Family
PHA02973

?
PHA02973: PHA02973 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165277
View PSSM: PHA02973
Aligned: 2 rows
Threshold Bit Score: 150.461
Threshold Setting Gi: 40556044
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556044   1 MTLLIFFLVLFLLLCYFLNFKRTNKMDIGINPIKKTPWSGNDHLFVSTLFHNNNKYVTGPMKLNYDPEKKGVVIEFKNTK 80 
9634748    2 TLFLVIFFILFLLLCYFFSFKRTNKMEIGINPIKKIPWSDNEHIFVSSLFTNKDKYLTGPMRLTYRPDSKTAVLDFKGTN 81 
40556044  81 YTYDLTDFADARKLIPTLLLSK 102
9634748   82 YTYYLDNFDDVRKLVPTLLLSK 103
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap