Conserved Protein Domain Family
PHA02969

?
PHA02969: PHA02969 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165274
View PSSM: PHA02969
Aligned: 2 rows
Threshold Bit Score: 130.925
Threshold Setting Gi: 40556026
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634735    2 VSNYCVVFMLNNYSSDDYKKIKSLDYHYLILDKHSDSSHKTISGYVELKDGISCSIIEnINSRILYKKLQGNKDFLRINK 81 
40556026   1 MSYVSIHFILYDYSDDDYSRIKSINCHHIIISKEVVDSVPIISGYIKLKKQALNSITK-INPNLIYEILKDTCSLDIYKK 79 
9634735   82 KNivdsfkskgcYEEYRSRRL-DLSIFDYYK 111
40556026  80 NN----------YEEYKKPAMiDLRVFDYYK 100
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap