Conserved Protein Domain Family
PHA02968

?
PHA02968: PHA02968 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165273
View PSSM: PHA02968
Aligned: 2 rows
Threshold Bit Score: 641.68
Threshold Setting Gi: 9634733
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556154   1 MLSTKVFKLDKKYSTSKFL-NTDNMRKERFIFDKFLSKFGRLLDIKLLTKPSGEK---ISFYVDKFCTVIVVLGVPyinD 76 
9634733    1 MISTYTNILSNNYSLDRFMiDEKNISVNRFRFDRFLSKFGNIINIRMLNGIIVNKyttISLKLHNSHLLILVLDLP---D 77 
40556154  77 KVNINVNTFNTLNCYYRVNINSYIVVNNTLASYRIDITCisdehININRRREHLQDLSTSKnnSFTVLTCFFDREHIN-K 155
9634733   78 NIKLKVGIDRLKLFLKRLSARYYMVINSSEHTNHIVITT-----VKINNNEEEQYKLTLGK--KYKILICYYDSNMLRyK 150
40556154 156 PITQGNKYLLI---GNYIREWIIYKKNVEIIDDNLERITSRKVTSHYYINENNHRVIRDTSIGCSDIVVSVKLSKITNSD 232
9634733  151 SIEQNNKKALLvgcGFIIGKWYIEKKKTRVVKHSISRITKKCITSEYYLDRTNIKVTDISSINAYWICNPIYHYKYKISD 230
40556154 233 V--RKDKYLMQALRWPLGNPSLIFFKLWFSTEYYRCRMNMNSIVSILKSITRKNVTSNYGLGDLLLSSFGIVRKQANKLG 310
9634733  231 IlkSKNKSLIQALRWPLGKPSITFFRLWIIGEYGTHNINLDTIVRILKRMTGRKITNNCGLGDILIYAFGIVRKQANKLG 310
40556154 311 INCSRISFRNLWKDIVLIQMKRYYKLKkrSLLSKFKVQTASLLVpdiPDIPDYQYLPTNPWMVDITKEVELWDDLRMNIL 390
9634733  311 LDCKRITFRNFWKEVASIQLIRYNKYK--SSMDNKNKQNNKVIS---PDNNQYKYLPFNPWMLDISKEVELWDDLKLNLL 385
40556154 391 DKEKWSYDWPALSR 404
9634733  386 DKNKWYNDWPVLSR 399
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap