Conserved Protein Domain Family
PHA02967

?
PHA02967: PHA02967 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165272
View PSSM: PHA02967
Aligned: 2 rows
Threshold Bit Score: 227.592
Threshold Setting Gi: 40556115
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634802    1 MDRNINFSPVFIEPRFKHEFlLSPQRYFYILVFEVIVALIILNFFFKEEILYTFFPLAKPSKNSINSLLDRTMLKCEEDG 80 
40556115   4 DNKNVTFSPVFIEPRFKHEF-LSSNKYFYILVFEVIVALIIINFFFKEEVLYAFLPLQKPPKNSINSLLDKTFLKCEENG 82 
9634802   81 SLMISRPSGIYSALSLDGSPVRISDCSLLLSSINGASSSTSPYSIFNR 128
40556115  83 SLMIVRPSGTYPALNLEGNPIQISDCSLLLSSLNGRDRSTSPYSIFNR 130
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap