Conserved Protein Domain Family
PHA02965

?
PHA02965: PHA02965 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165270
View PSSM: PHA02965
Aligned: 2 rows
Threshold Bit Score: 725.252
Threshold Setting Gi: 9634780
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556075   3 RNISNRQELADSSSNEVSTAKSPKLDKNDTTNtanttntasfnelpFNFSDTPYYKLTKSDDEKVNINLTYGYNIIKIHD 82 
9634780    1 MDTNRKRSLDEHDTGEESPGKLQIVEINDEED--------------ITFTDNPYYKLVKSRDNSINLVPLVGCVMIKIND 66 
40556075  83 INNLLNDVNRLIPSTPS--NLSGYYKIPVNDMKIDCLRDVNNYLEVKDIKLVYLAHGNELPNINNYDRNFLGFTAVICIN 160
9634780   67 IKGVTDKVNKLLPKTSSktNSTSCINIPIDSIPLNFLDDGNKYFNVSEVSILQVSHGNDMMNIDKYVDGSFDYIAVLCLK 146
40556075 161 NTGRSMVMVKHCNgKQHSMVTGLCLIARSFYSINILPQIIGSSRYLILYLTTTKKFNDVWPEIFSTNKDKDSLSYLQDMK 240
9634780  147 NSGRSVIMLNHCN-KQHVMQDNFCLIFRSFYGINILTQIIGESVYLLVKLSPSDLFKIRWSSVIDSNRFMGKKFYIRNLQ 225
40556075 241 EDNHLVVATNMERNVYKNVEAFILNSILLEDLKSRLSITKQLNANIDSIFHHNSSTLISDILKRSTDSTMQGISNMPIMS 320
9634780  226 EDACIEKMKNMEKDIYKNIEFIIINSVLLEDLKSRLDITRELNHTIDKMFNHNNNTLFSDIIKLSEEIIDKDFKNMEKMS 305
40556075 321 NILTLELKRSTNTKNRIRDRLLKAAINSKDVEEILCSIPS-EERTLEQLKFNQTCIYEHYKKIMEDTSKRMDVGCRSLEH 399
9634780  306 DSVLADVKQISKTKNKLRERLLKAAISSKEVEEILSDIPViEEGTIKQFSLNQRAVYDHYKKVIYKNNSSLDLGCMNIEK 385
40556075 400 NYTANLYKVYGQNEYMITYILALISRINNIMETLKYNLVGLDEFTIRNINYIISQRTKKNQVSNTL 465
9634780  386 SYMFNLYKVYGQNEYMITYILNLINRVKKGMDAIKSNLGDIYKYNIDNINLVVSERINKVISGESL 451
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap