Conserved Protein Domain Family
PHA02963

?
PHA02963: PHA02963 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165269
View PSSM: PHA02963
Aligned: 2 rows
Threshold Bit Score: 270.266
Threshold Setting Gi: 40556069
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634774    1 MFKNYKYTLLSEDTNNMKLLIPGLEDDMEAgtienSGYRNISTKmFKDQVKDIVKKTYNQTYLQLLQLLERSNVDCNELE 80 
40556069   1 MFRNYKYQSLKDNDYEEEILVPGLEDDDET-----IGFKDNKTS-FEKQVLDIVRNNYKNNYKNLMLVSTKYNNTSNITE 74 
9634774   81 LLYRIININPRICHRFYINRYDSIFGSFNKLHEFISNVMIKIFKIGNSIYITFISDNTSLEINVDNDTEGRLMNIDYTIK 160
40556069  75 LLYKIISSDSTKKYTFNINYYDNIFGLYNKLHEFIYKKKVKILCDGNCISMMFIRDNVSLKIDIECDAEGQLMDTKYKIE 154
9634774  161 FGDVIILQLGRISIKFSGNFVIMKDILFLVTDSNKIVYNEDEFLLEIYNT 210
40556069 155 FNDVIKLQISGVEIIIIDKLIYLKNKIFIFCDDYKIVSNENDFLLEIENV 204
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap