Conserved Protein Domain Family
PHA02962

?
PHA02962: PHA02962 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165268
View PSSM: PHA02962
Aligned: 2 rows
Threshold Bit Score: 1221.32
Threshold Setting Gi: 9634771
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556066   1 MFNINKLIDIYEDNSYVPGDYKNSQLQRSFMELPIIDIIDLIKLDFYPQCLPKKLYPAISASCVDKIYLFNPKYIQLQDL 80 
9634771    1 MFDITNLIELYESNDYVSGDYKHSQLQKAFLKLPITEVVMLVKSGFYPSKLSKKFYKPIAKFCVDKIYLFKPEYVSLKDL 80 
40556066  81 FLVIDLFDDLSKYKNIILYYKYEILKSNNYSIINKCKDIIGiHETDNENILIEDISDKELMDKMIEFPNFMKLVYKKRVL 160
9634771   81 FTVIYTFDDLSKYKEIIRYYYYELSVSNSYQVYKKCKNILG-YKDEYDNDIIEELSENDLVEKMVNFPGFRKIVYKKKIL 159
40556066 161 SIRILKEMYYKHRILPINKGITFVKEDDICFFVDSLESADSDEDTLYLILECNDKILDSEEVKDAVMRKICKGQNIDVLG 240
9634771  160 SIRILKEMYYKHKVLPINKGITPIREEDICFFIDALYDAHDDDDVLYLLLEINEQILDSDEVKETIIRKICKGENIDVLR 239
40556066 241 YYVKNYFLDHTKLGIYYNIFFAERDIVSEYGLKDDSLAIICKYIDKYSKSIRSIAKLLINNSNYSLLATIIDRVPDDMHN 320
9634771  240 YYVSHYLIDHAKLGVYYNIFFSERDIISEYGLTDESLKVICKYIDRYSSSIPSIIKLLLDNSNYTLLASVIDYIPEERLN 319
40556066 321 ENLYMNIIRHVTDKKPKIKNLKSDFFSECLMVMCYLRGYEDIVDFLNGLDVESMIKNRVNPFNDYVFTTDWFNKNTELLK 400
9634771  320 ENLYMQIVRHSNDNKPKIKSFKAEFLSECLMVMCYLRGYEDIVDFLIALDVETIVRNRINPFNDYTFTTDWFNKNTELVR 399
40556066 401 LYISFYFLDPTMMRKLLFEYPLSEESTRIALENIKKAYSflSIKDNY-INFSVNFDIIELPRVFNIPVKKIADLKEFNNT 479
9634771  400 LYISFYFIDPVMMRKLLFEYPLCETSTTVAIEELKKYRS--SINNNYnIDYHEEFKIVDLPRSFNIPISEVVSTKEYNSI 477
40556066 480 IPFISNKSYNFKIASQLLKYNVLKSVKVENLCYHRKKNLYYLCFNTYRETsispGARNNTVRLIDQIGDIGRLFRHGFIS 559
9634771  478 ISFISDKSYKFKITSQLLKYNILQTIKVENLCYSHINNLHSFYFNITKPS----GIIDNISRLIYQIGDLGRLLRHGFLS 553
40556066 560 FNDYHFGSWLPSLYSSKLLDYFQYNGPDYILSWSIDNIDFKSFVRYKDLPIFFSKKYTTSYLPDKKTLLYSCIYSCILLY 639
9634771  554 FTDNYFGKWIPSLNYSKILDHYQYNGPDYVLSWQIGKLDLKAFVKYKDFPKFFLTKYNIDFLLEKEVLLYYCIYSYLLLY 633
40556066 640 ILVGSVIYTERENIYYFISNIINSFLKGIGIDTAFNLELQDVVKEIIIISNLPEGKRNLSLVKPVNLLDLCKRICVFVSN 719
9634771  634 ILVGSVTYVEQENIYYFITNIINSFIQGLGIRNSIDSLSEEVVKELIIIQKLPENKRKLSSIRPVSLLNLCKRVCAFISR 713
40556066 720 NG 721
9634771  714 DG 715
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap