Conserved Protein Domain Family
PHA02961

?
PHA02961: PHA02961 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165267
View PSSM: PHA02961
Aligned: 2 rows
Threshold Bit Score: 1132.71
Threshold Setting Gi: 9634761
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634761    1 MANLYSKKVRKSIRKFIRSGLNFDLLHEKHGRRLIINNIFVKLPPKYYNFAKGLDLNNILAFDSEIIQLNDLKKLIMRLP 80 
40556056   1 MKGLYPKDLRKSINELVKVNLDFRLLSTKTAHTLIKYNVFSKLPDKYYDFAKKLDINNILAFDHKTVELRDLKKLISKLP 80 
9634761   81 LLPDCFTDVISCHKKYLLSDAAIVNKLINSNMVSLSDIRNIIDNRIKTPVEIALLNSSLVIPGTPFSLDEVKYIFENTSA 160
40556056  81 HIPECFTEIVAYHKKYLLLDRYVVFKLVESNIINLSDIRTILDNWVMTPIEIALINSDMIIPGTHFTLEDIKTVFDRKGL 160
9634761  161 ENVKELYKRIETPIHSVLYMEEKFSISPVHSSLYQVTDVDKIIYLIKKYPDDDIIDYVNGIVKSKKDFIESIITIIKDRL 240
40556056 161 DSTLKLYKKIDTSVYNILLMEEKFSVPPIHSSIYQLMDIDKAIFLIKKYPEEDVITNINGTVKSHNRFLQSMIDLVLSKL 240
9634761  241 PDISPCLNKWISTQLPPDKLRDEFGIYFYALFEWIDIPLYIDKYLFLNITEDETKFICRYIDIYKKKSELFVNAFRWHLY 320
40556056 241 PNVLTHINRWIATQLCSDKLLATFGIYFYVLFDWIDIPLYVDKYYFNRMTEEETTFICKHIDIYRKKSELFVNTLRWHLY 320
9634761  321 YCNSMYPQKVFPVITYKQDSKEKYVVKESFKYLDNKQTMKVLLNDFKYNYAIGKYILDSSSSNEVKMDALNMLQKQVVCL 400
40556056 321 YSDNMHTQKIFDPVTCKKEKHKNYMIKESFEYLDNEANIAILLNDFKYNYAISKYILESKASESLKLEAFKILSKQGTCI 400
9634761  401 ENAKCFDLGNLYSVLIKFQyhpvdyvmYSDKLLDYMSKNSTFDNN--DIGLLTLASFLFSTAKKGIIDINFLNTNSLWSP 478
40556056 401 DNCTCMELGALYSAIIRFP--------HSNKCISYNCDMTELDYNisDIGLGKLVYKMCNAAKKGMIDVRFLKTNCLWSP 472
9634761  479 LMYLIDDSCKVDFTRFMMATKNIKADNINYLKNKDENiNNNFEHIDNIDIYKLLDYSRIKLYGINFIKKVILANVIFEYI 558
40556056 473 VMYLLEDTSKVNFSRFMNAVKNISADNVKYLNKLEYN-DIRLEHINDLDIYKLLEYDRVHLYGINYVKKIIFANTIFEYI 551
9634761  559 FTLIIIRYQKTSYNLRSFLEMLLYRCLKGFGISPKLYKNVYVNEMNICCELENLINNYVVPFKTYGILMKLLITIFNNLN 638
40556056 552 ITVLIIRFKRSSYNFRRFIELLIYKCLKGFEIPVDTYKDVYVNEMNICIELERLINDSIIPFITHGLIIKLLVNIFTNLN 631
9634761  639 GISKHSFRIRVRKSKTLL 656
40556056 632 GIGKYSPRIRIRKGKISI 649
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap