Conserved Protein Domain Family
PHA02957

?
PHA02957: PHA02957 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165266
View PSSM: PHA02957
Aligned: 2 rows
Threshold Bit Score: 328.955
Threshold Setting Gi: 40556139
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634823    1 MIL----------AWKIIYLAILLYIPTERLVLSHTVITRSKLSTedneiddvPTCPYRMFNKKKIMGPIVSVKSPD-NP 69 
40556139   1 MIFfsvykyntnyNFKLVFYTMRRITSLLLLLICITCTVASKPSR--------PVCPRKMFNLRKGSGPVVNMVAPDgDP 72 
9634823   70 TGPIMALDAYHNYTSCKYNQYCTFFDFCMAGNTTIRFGRQKINLIYFVFIEAVTRDDYTKITQEVTLKHLDDVRFKPVSV 149
40556139  73 TAPVVALNNWHKNTSCKYNDYCTFFDFCFAGAVNISFGKQKIEVVYYFYVKAVTRDDYTKITQEITLKHSDDLRVKPLTV 152
9634823  150 TFAALYKQFVKMSAYHECNKTgfkkpvRDSCRKDSNSAIQYSNEQK 195
40556139 153 SFMPLNKDKVKIPSSHECMKG------KGKGKANSKTVIDVCGNRG 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap