Conserved Protein Domain Family
PHA02956

?
PHA02956: PHA02956 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165265
View PSSM: PHA02956
Aligned: 2 rows
Threshold Bit Score: 346.175
Threshold Setting Gi: 9634819
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556134   1 MAMCNN--TTACVHSLDAEELCykwLPIRSRYLQDYELISYMTKKFNKLFTARKLNIFAKYYWINTINRISVIGEHRPWV 78 
9634819    1 MNICINpeSTNCVHSTNDVKAR---TPIKNKYLPDYALIRFMIKKFNKLFIEKGLPITAVYSWTVFREAAICRGQYRSWI 77 
40556134  79 MSFINTTTGKRIADFRLDRSYPDSRMNSIIVDSSTGKIICEGIGLIDMLRSNGIDFIKDKLFSEDEIVNHLVGVQKLKDL 158
9634819   78 MSFIHTISGNNIANFRLDRAYSDSRYNSIIIDSTSGKIICEGIGIMEKLRLHGVDFINDKLFTEEEIITHVYGVQPLQDI 157
40556134 159 CIKYINKTVKKELCDQLSLPTTLLNEVKR 187
9634819  158 CIRMIRNTVSRDDYDKLELPRSLLKEIKK 186
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap