Conserved Protein Domain Family
PHA02955

?
PHA02955: PHA02955 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165264
View PSSM: PHA02955
Aligned: 2 rows
Threshold Bit Score: 372.381
Threshold Setting Gi: 40556077
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9634782    1 MENQQVISNLYYLFSEKYLEKLNQHPDTSNVRCGIHIGYLSGEAKNCIVSIINACNSNEQKSFQLLIESLIETIENLPEK 80 
40556077   1 MENNQVLSNLYYLFSEKYLEKLSKYQDVSSINCGIHIGRISGYAKNCRISIVNACNSDGEKNFQLLLEALVETIENFPNK 80 
9634782   81 QQKEIAKSIGINIDDYKAGKKTELQQHCEAYANLTQHIDIQHFNIGTCYSPNDKYTDIKIINTGSALSNCGVEIILNKIK 160
40556077  81 ERNRIAADLGVNIEDYKLGKKTDLQLHCESYASLTQHIDIQNFNIGTCYSPNDKYVDIKVINTGSAISNCGVEIVLNKLL 160
9634782  161 TNNPIVPIDNKLSMESFSIKWFIIYIVLCVLILLLLGYIYRTVRIKYTYGVYI 213
40556077 161 RSNKSVPIDNKLSMDTFSIKWLVIYIVLILSILIILGYIYRTVRLKYIYGVYI 213
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap