Conserved Protein Domain Family
PHA02954

?
PHA02954: PHA02954 
EEV membrane glycoprotein; Provisional
Statistics
?
PSSM-Id: 165263
View PSSM: PHA02954
Aligned: 7 rows
Threshold Bit Score: 563.556
Threshold Setting Gi: 22164590
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275984    1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSD 80 
9627696     1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYYSLDPNAVCETDKWKYENPCKKMCTVSD 80 
17975080    1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYHSLDPNAVCETDKWKYENPCKKMCTVSD 80 
22164590    1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKHKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCTVSD 80 
18640415    1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYYSLDPNAVCETDKWKYENPCKKMCTVSD 80 
20178559    1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYYSLDPNAVCETDKWTYENPCKKMCTVSD 80 
113195365   1 MKTISVVTLLCVLPAVVYSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDSGYYSLDPNAVYETDKWKYENPCKKMCTVSD 80 
66275984   81 YISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVG 160
9627696    81 YVSELYNKPLYEVNAIITLICKDETKYFRCEEKNGNTSWNDTVTCPNAECQSLQLDHGSCQPVKEKYSFGEHITINCDVG 160
17975080   81 YVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVG 160
22164590   81 YVSELYDKPLYEVNSTMTLRCNSETKYFRCEEKNGNTSWNDTVTCPNAECQPLRLEHGSCQPVKEKYSFGEYMTINCDVG 160
18640415   81 YVSELYDKPLYEVNATITLICKDETKYFRCEEKNENTSWNDTVTCPNAECQSLQLEHGSCQPVKEKYSFGEHITINCDVG 160
20178559   81 YVSELYDKPLYEVNSTITLTCKDETKYFRCEEKNGNTSWNDTVTCPNAECQPLRLEHGSCQPVKEKYSFGEHITINCDLG 160
113195365  81 YVSELYDKPLYEVNATITLICKDETKYFRCEEKNGNTSWNDTVTCPNAECQSLQLEHGSCQPVKEKYSFGEHITINCDVG 160
66275984  161 YEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRT 240
9627696   161 YEVIGASYITCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICIRS 240
17975080  161 YEVIGVSYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRS 240
22164590  161 YEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRS 240
18640415  161 YEVIGASYISCTANSWNIIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSSSSTCIDGKWNPVLPICVRS 240
20178559  161 YEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFRLTGSSSSTCIDGKWNPVLPTCVRT 240
113195365 161 YEVIGASYISCTANSWNVIPSCQQKCDIPSLSNGLISGSTFSIGGVIHLSCKSGFILTGSPSSTCIDGKWNPVLPICVRS 240
66275984  241 NEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP 317
9627696   241 NEEFDPVEDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCNKNNDQYKFHKLLL 317
17975080  241 NEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIMALTIMGVIFLISIIVLVCSCDKNNDQYKFHKLLP 317
22164590  241 NEEFDPIDDDPDDETDLSKISKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISIIVLVCSCDKTNDQYKFHKLLP 317
18640415  241 NEEFDPVEDGPDDETDLSKLSKDVVQYEQEIESLEVTYHIIIVALTIMGVIFLISVIVLVCSCNKNNNQYKFHKLLP 317
20178559  241 KEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIIGVIFLISVIVLVCSCNKNNDQYKFHKLLP 317
113195365 241 NEEFDPVEDGPDDETDLSKLSKDVVQYEQEIESLEATYHIIIVALTIMCVIFLISVIVLVCSCNKNND-HKFHKLLP 316
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap