Conserved Protein Domain Family
PHA02953

?
PHA02953: PHA02953 
IEV and EEV membrane glycoprotein; Provisional
Statistics
?
PSSM-Id: 165262
View PSSM: PHA02953
Aligned: 18 rows
Threshold Bit Score: 258.14
Threshold Setting Gi: 17975059
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9633758     1 MKTLNRQTVGKIKKMSTPAAIFMIISTIVSGIGTVLRYKDDLFPNACDRGWMSYDNYCYLNTKIQLSVYGGAVLCANHKA 80 
157939747   1 MKSFNRQTVNKIKRYSTPAAIFMILSTVVSGIGTVLKFKHELFPSACARGWIPYDNYCYLDTNLQLAANGALNVCNSYKA 80 
148913001   1 MKSLNRQTINKIKRASAPTAVFILVLTIVSSICTAIRYKDELFPNVCNKGWVQYDDSCYLNSKLQLSLYGGVMLCNKYNA 80 
21492575    1 MKSLNRQTINKIKRASAPTAIFVLVLTIVSSIGTAIRYKDELFPNACNKGWVPYDDSCYLNSKLQLSLYGGVMLCNKYNA 80 
15150562    1 MKSLNRQTINKIKRASAPTAIFMLVSTIVSGIGTAIRYKDELFPNACNKGWVPYDDSCYLDSRLQLSLYGGVMLCNKYNA 80 
18640206    1 -MKLNRQTVNKFKRLTTPAAIFMIISTIVSGIGTILKYKNELFPSACTKGWLPYDNYCYLDTRVKLTIYGALSLCNTYNA 79 
9633932     1 MKMLNRQTVGKIKKISTPAAIFMIISTIVSGIGTVLRYKDDLFPNACDRGWMSYDNYCYLNTKIQLSVYGGAVLCANHKA 80 
12085106    1 MKSFNRQTVNKIKKYSTPAAIFMILSTVVSGIGTVLKFKHELFPSACARGWIPYDNYCYLDTNLQLAANGALNVCNSYKA 80 
9627662     1 MKSLNRQTVSRFKKLSVPAAIMMILSTIISGIGTFLHYKEELMPSACANGWIQYDKHCYLDTNIKMSTDNTVYQCRKLRA 80 
62637510    1 MKSLNRQTVNKLKKMTTPAAIFMIISTIISGIGTVLKYKTELFPSACPKGWVPYDNYCYLDTKLQLSAYGAVSICNNYDA 80 
9633758    81 RIPKANFRHLKVISLTYGRDFWVSLTKqKDGRWIDINTNKTVNMDSSRELAEIKKKNTGaTDASCYVYKLNGIQEILCNV 160
157939747  81 RLPKTNFRHLKVLSLTYSKHFWVGLKK-KDNRWLDISTNKTIDMNSNIDLTKTKGKYDN-ENSICFVYKMGELKGVICDI 158
148913001  81 KIPNVSIKHLKVISLTYGRQFWYGLVKkKNNIWVDVNSNSTVDMNKNTELSTIKKSSKE-DINACYVYNFGQFKNVSCNY 159
21492575   81 KIPNVSIRHLKVISLTYGRQFWYGLVKkKNNIWVDVNSNSTVDMNKNTELSNIKKSSKG-DINACYVYNFGQFKNVSCNY 159
15150562   81 KIPNVSIRHLKVISLTYGRQFWYGLVKkKNNIWVDVNSNSTVDMNKNTELSNIKKSSKG-DINACYVYNFGQFKNVSCNY 159
18640206   80 KIPKTNFRHLKVMSLTYGKQFWVSLSK-QGNSWIDININKTVDMSNSIELTKIRNSNNN-KNECCYTYKMGELKETVCNI 157
9633932    81 RIPKANFRHLKVISLTYGRDFWVSLMKqKDGRWIDINTNKTVNMDGSRELVEIKRKHMD-NDTSCYVYKLNGIQEILCNV 159
12085106   81 RLPKTNFRHLKVLSLTYSKHFWVGLKK-KDNRWLDISTNKTIDMNSNVDLTKTKGKYDN-ENSICFVYKMGELKGVICDI 158
9627662    81 RLPRPDTRHLRVLFSIFYKDYWVSLKK-TNNKWLDINNDKDIDISKLTNFKQLNSTT---DAEACYIYKSGKLVKTVCKS 156
62637510   81 RLPKANFRHLRVAYLTYGKVFWVSLTR-HNNRWSDINTNKTVDMNGSMELIKLNQKQ---KKDSCFIYKSGEMMETLCNI 156
9633758   161 VNYVICMKRFYK 172
157939747 159 VNYIVCVKKFYK 170
148913001 160 VSYIICVKRLYN 171
21492575  160 VSYIICVKRLYN 171
15150562  160 VSYIICVKRLYN 171
18640206  158 VNYILCVKRFYN 169
9633932   160 VNYVICMKRFYK 171
12085106  159 VNYIVCVKKFYK 170
9627662   157 TQSVLCVKRFYK 168
62637510  157 VNYIICVKRFYN 168
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap