Conserved Protein Domain Family
PHA02951

?
PHA02951: PHA02951 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 177499
View PSSM: PHA02951
Aligned: 11 rows
Threshold Bit Score: 322.205
Threshold Setting Gi: 15150465
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
211956305   1 MFSRMRYRYNNKKSYITK--NKNRHASSEYCfirKDIKKDNVLSD---------DISIFKSPIDVSDIVKHESFTCGFFT 69 
113195228  20 SSILARRPTPKKMNIVTD--LENSLKKNSYI---ENTNQGNILMD---------SIFVSTMPVETLFGSYITDDSDDYVL 85 
20178425   20 SSILARRPTPKKMNIVTD--LENRLKKNSYI---ENTNQGNILMD---------SIFVSTMPVETLFGSYITDDSDDYEL 85 
18640280   20 SSILARRPTPKKMNIVTD--LENRLKKNSYI---ENTNQGNILMD---------SIFVSTMPVETLFGSYITDDSDDYEL 85 
22164639   20 SSILTRRPTPKKMNIVTD--LENRVKKNSYI---ENTNQGNILMD---------SIFVSTMSVETLFGSYITDNSDDYEL 85 
17974956   20 SSILARRPTPKKMNIVTD--SENRLKKNSYI---ENTNQGNILMD---------SIFVSTMPVETLFGSYITDDNDDYEL 85 
18640109    6 ISLFSKYRKNDSHRYISK--ENNKYS----------------LKD---------DIYIDKMDIDNIRNEVSSLLDSDFIK 58 
9627556    20 SSMLARRHTPKKMNIVTD--LENRLKKNSYI---ENTNQGNILMD---------SIFVSTMSVETLFGSYITDDSDDYEL 85 
66275847   20 SSILARRPTPKKMNIVTD--LENRLKKNSYI---ENTNQGNILMD---------SIFVSTMPVETLFGSYITDDSDDYEL 85 
62637411    3 SRMIYRY---NKKSYRAK--NKNHHDSSEYCfirKDIKKDNVLSD---------EISIFKSPIDVSDIVKHESYTYGFFT 68 
15150465    1 -MSIMCLSNKKKEEYILKyfLNNRCYDDLYSvngGNVAVGNFLKSkseelyfsfNLFLNDLDISKKKVGF---------- 69 
211956305  70 EEINNVSYSWKKINIDNQMIDFLLDKDGLVSISDTYLVRLRHGNGFSKGTIFIGSSYGFIATICIKNDGISGLYIPKSVH 149
113195228  86 KDLLNVTYNIKPVIVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHSAGFTATICLKNEGVSGLYIPGTSV 165
20178425   86 KDLLNVTYNIKPVMVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHSAGFTATICLKNEGVSGIYIPGTSV 165
18640280   86 KDLLNVTYNIKPVIVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHSAGFTATICLKNEGVSGLYIPGTSV 165
22164639   86 KDLLNVTYNIKPVIVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHGAGFTATICLKNEGVSGLYIPGTSV 165
17974956   86 KDLLNVTYNIKPVIVPDIKLDSVLDRDGNFRPADCFLVKLKHSDGFTKGALYLGHSAGFTATICLKNEGVSGLYIPGTSV 165
18640109   59 EITDDVEYSWKKVYVNPVLFNSILDKEGYFTIDESFLIKLEHGNGFSKGAIHVGSSYGFTATICIKNDGISGICVPNSVY 138
9627556    86 KDLLNVTYNIKPVIVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHSAGFTATICLKNEGVSGLYIPGTSV 165
66275847   86 KDLLNVTYNIKPVIVPDIKLDAVLDRDGNFRPADCFLVKLKHRDGFTKGALYLGHSAGFTATICLKNEGVSGLYIPGTSV 165
62637411   69 EEINNVSYSWKKINIDNKMIDFVLDKDGLVSISDTYLVRLRHGNGFSKGTIFIGSSYGFIATICIKNDGISGLYIPKSVH 148
15150465   70 -------YSLKEINVN--IFYKLLLNEEFFTVIGSYLVKLKHGNAFFLNESTF--SNSVVITACVKNKGISGLFIPDTTF 138
211956305 150 LKINVEVGDYIISRASRGIKFLPQIGGDAVYLVVSIVPSKKLANLGFIVPTVITTQSSEKATSIICNRRLKIISIVDKII 229
113195228 166 IRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFVIPDISSNDNAKIAARILSEKRKDTIAHIDTLI 245
20178425  166 IRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFIIPEISSNDNAKIAARILSEKRKDTIAHIDTLI 245
18640280  166 IRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFVIPDISSNDNAKIAARILSEKHKDTIAHIDTLI 245
22164639  166 IRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFIIPEISSNDNAKIAARILSEKRNDTIAHIDTLI 245
17974956  166 VRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFVIPEISSNDNAKIAARILSEKRKDIIAHINTLI 245
18640109  139 LKTHVEEGDYIISRSSRGIKFLPHIGHHIIYLVLSIVPTKKLSKKGFVVPVIASTQTSSSTSYIVSNRYLKIIDLINTVI 218
9627556   166 IRTNICQGDTIVSRSSRGVQFLLQIGGEAIFLIVSLCPTKKLVETGFVIPNISSNDNAKIAARILSEKRKDTITHIDTLI 245
66275847  166 IRSNICQGDTIVSRSSRGVQFLPQIGGEAIFLIVSLCPTKKLVETGFVIPEISSNDNAKIAARILSEKRKDTIAHINTLI 245
62637411  149 LKINVEVGDYIISRASRGIKFLPQIGGDAIYLVVSIIPSKKLANMGFIVPTVIITQSSEKATSIICSRRLKIIGIVDKII 228
15150465  139 LKINIDEGDFIMSGFLNGVNFLPQIGGESIYLVTILSPKELSITEKAFFYKKNNEETLNITSNIISIRRLKIIELVNKII 218
211956305 230 KIRETIEKNYVASYLVSEFLSIYDSYykksnskhikeekrvtfsddVDTHRKNALEYQIEKinnkikdndfidnmklsmv 309
113195228 246 QYRQQLELVYYNSCMLTEFLHYCNSY--------------------ANTIKESLLKETIQK------------------- 286
20178425  246 QYRQQLELAYYNSCMLTEFLHYCNSY--------------------ADTIKESLLKETIQK------------------- 286
18640280  246 QYRQQLDLAYYNSCILTEFLHYCNSY--------------------TNTIKESLLKETIQK------------------- 286
22164639  246 QYRQQLEFAYYNSCMLTEFLHYCNSY--------------------ADTIKESLLKETIQK------------------- 286
17974956  246 QYRQQLELAYYNSCMLTEFLHYCNSY--------------------ADTIKESLLKETIQK------------------- 286
18640109  219 HKRDLLEKYYIAAYMTNELLSVYDSHilkhnnisvvknvtfsdddiYKKSINNDSRYDAEKsirk------------rii 286
9627556   246 QYGQQLELAYYNSCMLTEFLHYCNLY--------------------ANTIKESLLKETIQK------------------- 286
66275847  246 QYRQQLELAYYNSCMLTEFLHYCNSY--------------------AGTIKESLLKETIQK------------------- 286
62637411  229 KIRETIEKNYIASYLVSEFLSIYDSYykktnkhlkeekhvtfsddiIDTHRKNALEYQIEKinnkikdnnfidniklsmv 308
15150465  219 KLKKVMKKE--NNCYIPNNFVIYDTI----------------------LNKNNNFLYSFKK------------------- 255
211956305 310 nDIKGKNKIMNELWEELTLLSQEINNLLDHnhEQYSKINSYIIKIINENECSKVKSEIIANLhALSNVGLYT 381
113195228 287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDKIVNSL-SLSNLDFHL 354
20178425  287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDKIVNCL-SLSNLDFRL 354
18640280  287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDKIVNSL-SLSNLNFHL 354
22164639  287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDKIVNSL-SLSNLDFRL 354
17974956  287 -DINIIHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDKIVNSL-SLSNLDFRL 354
18640109  287 nKVNDKNLLIKNLWNEISNLYSRIEVLLDDddESLKLIDSYVIYKLSMGESYSLKEEIVNNLfALSNIGFRI 358
9627556   287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKNCGGVKNRDTIVNSL-SLSNLDFYL 354
66275847  287 -DINITHTNITTLLNETAKVIKLVKSLVDK--EDTDIVNNFITKEIKN------RDKIVNCL-SLSNLDFRL 348
62637411  309 nDIKGKNKIMNELWEELTLLSQEINNLLDHnhEQYSKINSYIIKIINENECSKVKSEIIANLhALSNVGLYI 380
15150465  256 ---KYKIDDDETLWEKITNLFLEIDKLLDYniKHYQLINEYIINKVK----------------------YYY 302
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap