Conserved Protein Domain Family
PHA02949

?
PHA02949: PHA02949 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165259
View PSSM: PHA02949
Aligned: 7 rows
Threshold Bit Score: 95.7161
Threshold Setting Gi: 17974953
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275844   1 MEGSKRKHDSRRLQQEQEQLRPRTPPSYEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
9627553    1 MEGSKRKHESRRPQQEQEQHRPRTPPSYEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
17974953   1 MEGSKRKHDSRRL-QEQEQPRPRTPPSYEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 64 
22164636   1 MEGSKRKHDSRRPQQEQEQQRPRTPPSYEEIAKYGHSLNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
18640277   1 MEGSKRKHESRRPQQEQEQHRPRTPPSCEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
20178422   1 MEGSKRKHDSRRPQQEQEQHRPRTPPSYEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
113195225  1 MEGSKRKHESRRPQQEQEQCRPRTPPSYEEIAKYGHSFNVKRFTNEEMCLKNDYPRIISYNPPPK 65 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap