Conserved Protein Domain Family
PHA02948

?
PHA02948: PHA02948 
serine protease inhibitor-like protein; Provisional
Statistics
?
PSSM-Id: 165258
View PSSM: PHA02948
Aligned: 7 rows
Threshold Bit Score: 709.507
Threshold Setting Gi: 66275830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17974941    1 MIALLILSLACSVSAYRLQGFINAGILAYKNIQNGDEDdnDNIVFSPFGYSFSMFMSLLSASGNTRVELLNTMNLRKRDL 80 
113195213   1 MIALLILSLACTASAYRLQGFTNAGILAYKNIQDGNED--DNIVFSPFGYSFSMFMSLLPASGNTRVELLKTMDLRKRDL 78 
20178410    1 MIALLILSLACTASAYRLQGFTNAGILAYKNIQDGDED--DNIVFSPFGYSFSMFMSLLPASGNTRVELLKTMDLRKRDL 78 
18640265    1 MIALLILSLACTASTYRLQGFTNAGILAYKNIQDGNED--DNIVFSPFGYSFSMFMSLLPASGNTRVELLKTMYLRKRDL 78 
22164761    1 MIALLILSLACTASAYRLQGFTNAGILAYKNIQDGNED--DNIVFSPFGYSFSMFMSLLPASGNTRVELLKTMDLRKRDL 78 
9627543     1 MIVLLILSLACTAFTYRLQGFTNAGIVAYKNIQDGNED--DNIVFSPFGYSFSMFMSLLPASGNTKVELLKTMDLRKIDL 78 
66275830    1 MIALLILSLTCSVSTYRLQGFTNAGIVAYKNIQD------DNIVFSPFGYSFSMFMSLLPASGNTRIELLKTMDLRKRDL 74 
17974941   81 GPAFTELISGLAKMKTSKYTYTDLTYQSFVDSTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTM 160
113195213  79 GPAFTELISGLAKLKTSKYTYTDLTYQSFVDNTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTM 158
20178410   79 GPAFTELISGLAKLKTSKYTYTDLTYQSFVDSTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTM 158
18640265   79 GPAFTELISGLAKLKTSKYTYTDLTYQRFVDNTVCIKPSYYQQYHRLGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTM 158
22164761   79 GPAFTELISGLATLKTSKYTYTDLTYQSFVDNTVCIKPSYYQQYHRFGLYRLNFRRDPVDKINSIVERRSGMSNVVDSTM 158
9627543    79 GPAFTELISGLAKPKTSKYTYTDLTYQSFVDNTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSTM 158
66275830   75 GPAFTELISGLAKLKTSKYTYTDLTYQSFVDNTVCIKPSYYQQYHRFGLYRLNFRRDAVNKINSIVERRSGMSNVVDSNM 154
17974941  161 LDDNTLWAIINTIYFKGTWQYPFDITKTHNASFTNKYGTKTVPMMNVVTKLQGNTITIDDEEYDMVRLLYKDANISMYLA 240
113195213 159 LDNNTLWVIINTIYFKGTWQYPFDITKTRNASFTNKYGTKTVPMMNVVTKLQGNTITIDDEEYDMVRLPYKDANISMYLA 238
20178410  159 LDNNTLWAIINTIYFKGTWQYPFDITKTRNASFTNKYGTKTVPMMNVVTKLQGNTITVDDEEYDMVRLPYKDANISMYLA 238
18640265  159 LDNNTLWAIINTIYFKGTWQYPFDITKTHNASFTNKYGTKTVPMMNVVTKLQGNTITIDDEEYDMVRLPYKDTNISMYLA 238
22164761  159 LDDNTLWTIINTIYFKGTWQCPFDIAKTHNASFTNKYGTKTVPMMNVVTKLQGNTITVDDEEYDMARLPYKDTNISMYLA 238
9627543   159 LDNNTLWAIINTIYFKGTWQYPFDITKTHNTSFTNKYGTKTVPMMSVVTKLQGNTITIDDEEYDMVRLQYKDANISMYLA 238
66275830  155 LDNNTLWAIINTIYFKGIWQYPFDITKTRNASFTNKYGTKTVPMMNVVTKLQGNTITIDDEEYDMVRLPYKDANISMYLA 234
17974941  241 IGDNMTHFTDSITAAKLEYWSSQLGNKMYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDKASFKHMTRDPLYIYKMFQNV 320
113195213 239 IGDNMTHFTDSIAAAKLDYWSSQLGNKVYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDNASFKHMTRDPLYIYKMFQNA 318
20178410  239 IGDNMTHFTDSITAAKLDYWSSQLGNKVYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDKASFKHMTRNPLYIYKMFQNA 318
18640265  239 IGDNMTHFTDSITAAKLDYWSSQLGNKVYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDNVSFKHMTRDPLYIYKMFQNA 318
22164761  239 IGDNMTHFTDSITAAKLDYWSSQLGNKMYNLKLPRFSIENKRDIKSIAEMIAPGMFNPDKASFKHMTRDPLYIYKMFQNA 318
9627543   239 IGDNMTHFTDSIMAAKLDYWSSQLGNKVYNLKLPRFSIENKRDIKSIAEMMAPSMFNPDNASFKHMTRDPLYIYKMFQNA 318
66275830  235 IGDNMTHFTDSITAAKLDYWSFQLGNKVYNLKLPKFSIENKRDIKSIAEMMAPSMFNPDNASFKHMTRDPLYIYKMFQNA 314
17974941  321 KIDVDEQGTVAEASTIMVATARSSPEELEFNTPFVFIIRHDITGFILFMGKVEST 375
113195213 319 KIDVDEQGTVAEASTIMVATARSSPEELEFNTPFVFIIRHDITGFILFMGKVESP 373
20178410  319 KIDVDEQGTVAEASTIMVATARSSPEQLEFNTPFVFIIRHDITGFILFMGKVESP 373
18640265  319 KIDVDEQGTVAEASTIMVATARSSPEELEFNTPFVFIIIHDITGFIFFMGKVESP 373
22164761  319 KIDVDEQGTVAEASTIMVSTARSSPTELEFNTPFVFIIRHDITGFILFMGKVESP 373
9627543   319 KIDVNEQGTVAEASTIMVATVRSSPEELEFNTPFVFIIRHDITGFILFMGKVESP 373
66275830  315 KIDVDEQGTVAEASTIMVATARSSPEKLEFNTPFVFIIRHDITGFILFMGKVESP 369
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap