Conserved Protein Domain Family
PHA02946

?
PHA02946: PHA02946 
ankyin-like protein; Provisional
Statistics
?
PSSM-Id: 165256
View PSSM: PHA02946
Aligned: 7 rows
Threshold Bit Score: 846.26
Threshold Setting Gi: 17974938
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275827   26 MDNIMSAEYYLSLYAKYNSKNLDVFRNMLQAIEPSGnNYHILHAYCGIKGLDERFVEELLHRGYSPNETDDDGNYPLHIA 105
113195209   1 MDNIMSAEYYLSLYAKYNSKNLDVFRNMLQAIEPSG-NYHILHAYCGIKGLDERFVEELLHRGYSPNETDDDGNYPLHIA 79 
20178407   28 IDNIMSAEYYLSLYAKYNSKNLDVFRNMLQAIEPSG-HYHILHAYCGIKGLDERFVEELLHIGYSPNETDDDGNYPLHIA 106
18640262    1 MDNIMSAEYYLSLYAKYNSKNLDVFRNMLQAIEPSG-NYHILHAYCGIKGLDERFVEELLHRGYSPNEKDNDGNYPLHIA 79 
22164628   24 MDKIISDEYYLYLYAKYNSKNLDVFRNMLRTIEPSG-NYHILHAYCGIKGLDERFVEELLHRGYSPNETDDDGNYPLHIA 102
17974938    1 ----MSVEYYLSLYAKYNSKNLDVFRNMLQVIEPSG-NYHILHAYCGIKGLDERFIEELLHRGYSPNETDDDGNYPLHIA 75 
9627539     1 MDNIMSAEYYLSLYTKYNSKNLDVFRNMLQAIEPSG-NYHILHAYCGIKGLDERFVEELLHRGYSPNETDDDGNYPLHIA 79 
66275827  106 SKINNNRIVAMLLTHGADPNACDKHNKTPLYYLSGTDDEVIERINLLVQYGAKINNSVDEEGCGPLLACTDPSERVFKKI 185
113195209  80 SKINNNRIVAMLLTHGADPNACDKQHKTPLYYLSGTDDEVIERINLLVQYGAKINNSVDEEGCGPLLACTDPSERVFKKI 159
20178407  107 SKINNNRIVATLLAHGADPNACDKQHKTPLYYLSGTDDEVIERINLLVRYGAKINNSVDEEGCGPLLACTDPSERVFKKI 186
18640262   80 SKINNNRIVAMLLTHGADPNACDKQHKTPLYYLSGTDAEVIERINLLVQYGAKINNSVDEEGCGPLLACTDPSERVFKKI 159
22164628  103 SKINNNRIVATLLTHGADPNACDKQNKTPLYYLSGTDDEVIERINLLVQYGAKINNSVDEEGCGPLLACTDPSEKVFKKI 182
17974938   76 SKINNNRIVAMLLVHGADPNACDKHNKTPLYYLSGTDDEVIERINLLVQYGAKINNSVDEEGCGPLLAYTDPSERVFKKI 155
9627539    80 SKINNNRIVAMLLTHGADPNACDKQHKTPLYYLSGTDDEVIERINLLVQYGAKINNSVDEEGCGPLLASTDPSERVFKKI 159
66275827  186 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLHIVCSKTVKNVDIIDLLLPSTDVNKQN 265
113195209 160 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLHIVCSKTVKNVDIINLLLPSTDVNKQN 239
20178407  187 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLHIVCSKPVKNVDIINLLLPSTDVNKQN 266
18640262  160 MSIGFEAMIVDKFGKNHIHRHLMSENPKASTISWMMKLGISPSKPDHDGNTPLHIICSKTLKNVDIINLLLPSTDVNKQN 239
22164628  183 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKTDHDGNTPLHIVCSKSVKNVDIINLLLPSTDVNKQN 262
17974938  156 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLHIVCSKTVKYVDIINLLLPSTDVNKQN 235
9627539   160 MSIGFEARIVDKFGKNHIHRHLMSDNPKASTISWMMKLGISPSKPDHDGNTPLHIVCSKTVKNVDIINLLLPSTDVNKQN 239
66275827  266 KFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDVLEIINDKGKQYDSTDFKMAVEVGSIRCVKYLLDN 345
113195209 240 KFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDILEIINDKGKQYDSTDFKMAVEVGSIRCIKYLLDN 319
20178407  267 KFGDSPLTLLVKTLTPAQLINKLLSTSNVITDQIVNICIFYDRDDVLEIINDKGKQYDSTDFKMAVEVGSIRCVKYLLDN 346
18640262  240 KFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDILEIINNKGKQYDSTDFKMAVEVGSIRCIKYLLDN 319
22164628  263 TFGDSPLTLLIKTLSPAHLINKLLSASNVITDQTVNICIFYDRDDVLEIINDKGKQYDSTDFKMAVEVGSIRCVKYLLDN 342
17974938  236 KFGDSPLTLLIKTLSPAHLINKLISTSNVITDQTVNICIFYDRDDVLEIINDKGKQYDSTDFKMAVEVGSIRCVKYLLDN 315
9627539   240 KFGDSPLTLLIKTLSPAHLINKLLSTSNVITDQTVNICIFYDRDDILEIINDKGKQYDSTDFKMAVEVGSIRCIKYLLDN 319
66275827  346 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDFVVNGHTCMSECVRLNNPVILSKLMLHNPTSETMYLTMKAIEKDRLDKS 425
113195209 320 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSVVNGHTCMSECVRLNNPVILSKLMLHNPTSETMYLTMKAIEKDKLDKS 399
20178407  347 DIICEDAMYYAVLSEYEAMVDYLLFNHFSVDSVVNGHTCMSECVRINNPIILSKLMLHNPTSETMYLTMKAIEKDRLDKS 426
18640262  320 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSVVNGHTCMSECVRLNNPVILSKLMLHNPTSETMYLTMKAIEKDKLDKS 399
22164628  343 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSVVNGHTCMSECVRLNNPVILSKLMLHNPTSETMYLTMKAIEKDKLDKS 422
17974938  316 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSIVNGHTCISECVRLNNPVILSKLMLHNPTSETMYITMKEIEKDKLDKS 395
9627539   320 DIICEDAMYYAVLSEYETMVDYLLFNHFSVDSVVNGNTCMSECVRLNNPVILSKLMLHNPTSETMYLTMKAIEKDKLDKS 399
66275827  426 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 472
113195209 400 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 446
20178407  427 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 473
18640262  400 IIIPFIAYFVIMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 446
22164628  423 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 469
17974938  396 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYEVFDDYF 442
9627539   400 IIIPFIAYFVLMHPDFCKNRRYFTSYKRFVTDYVHEGVSYKVFDDYF 446
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap