Conserved Protein Domain Family
PHA02945

?
PHA02945: PHA02945 
interferon resistance protein; Provisional
Statistics
?
PSSM-Id: 165255
View PSSM: PHA02945
Aligned: 5 rows
Threshold Bit Score: 137.062
Threshold Setting Gi: 20178411
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275831   1 MLAFCYSLPNAGDVIKGRVYEKDYALYIYLFDYPHFEAILAESVKMHMDRYVEYRDKLVGKTVKVKVIRVDYTKGYIDVN 80 
9627544    1 MLVFCYSLPNVGDVLKGKVYENGYVLYVDLFDYPHSEAILVESTQMHMNRYFKYRDKLVGKTVKVKVIRIDYTKGYIDVN 80 
18640266   1 MLAFCYSLPNVGDVLNGKVYENGYALYIDLFDYPHSEAILAESVQMHMNRYFKYRDKLVGKTVKVKVIRVDYTKGYIDVN 80 
20178411   1 MLAFCYSLPNAGDVIKGRVYENDYALYIDLFDYPHSAAILAESVQMHMDRYFKYRDKLVGKKVKVKVIRVDYTKGYIDVN 80 
113195214  1 MLAFCYSLPNVGDVLKGKVYENGYALYIDLFDYPHSEAILAESVQMHMNRYFKYRDKLVGKTVKVKVIRVDYTKGYIDVN 80 
66275831  81 YKRMCRHQ 88 
9627544   81 YKRMCRHQ 88 
18640266  81 YKRMCRHQ 88 
20178411  81 YKRMCRHQ 88 
113195214 81 YKRMCRHQ 88 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap