Conserved Protein Domain Family
PHA02943

?
PHA02943: PHA02943 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165253
View PSSM: PHA02943
Aligned: 3 rows
Threshold Bit Score: 262.88
Threshold Setting Gi: 47131203
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
47131203   1 MPRKMSDTMHTRMIKTLRYMitEAPCTTIARVANKLDVSWSMARNALYQLAKNKMVLKVEISRATIWCVDENAATNAIFE 80 
47131159   1 MPIGHSREVLVRLRDILALL--ADGCKTTSLIQQRLGLSHGRAKALIYVLEKEGRVTRVAFGNVALVCLSMDQYRQLVDG 78 
47131160   1 MPTGITERVKNRKKAVLELL--ADGCKSTSYIMRTLGTTHVEAYYVLKTLAREGCIREWKIGKSAVWCLNDDEYNNLVNT 78 
47131203  81 IKRTLWRLICNSRRRYITPSDMLRLIAADTEAHNIFAKYVDVNSTHGHTLHFIASALEDLLGKPMDKRQRRLLFHVTPRF 160
47131159  79 MIREVERLVTTNKLKFISPPRLHDLIIKDPQARKFFSSIIPIAHRTAIILSFLNHLLKMIYGEPYVKTDETVYLTANRKV 158
47131160  79 ILREIQRIVESYNLKFVYPMRLYRLIQKDYKVLRLIAKLVPVDYRNAAILSFLNGALRMLYGEPYTKGEKTVYFVTKSGI 158
47131203 161 CKKAPTL 167
47131159 159 HIEPPAK 165
47131160 159 NQPQTTV 165
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap