Conserved Protein Domain Family
PHA02942

?
PHA02942: PHA02942 
putative transposase; Provisional
Statistics
?
PSSM-Id: 165252
View PSSM: PHA02942
Aligned: 2 rows
Threshold Bit Score: 747.614
Threshold Setting Gi: 75750418
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
75750418   1 MARREKNPIRATVAMNIGLSDSLLAFVNNYVKALRFSLFWMKENVKNPNEKGALSKVHEGLYEKLRKEYNLPSKVTEDCY 80 
75750409   1 MARREKNPIRATVSMKIGLSDSLLAFVNNYVRALRFSIFWMKENVKNPNEKGTLSKVHEGLYGKLKEDYNLPPKVSADCY 80 
75750418  81 RDALAIYKSWYNNPKKGRFPRVYKPTVWLTPKQSYTVDLEKMTVRIASVGELPILGYPRNLKEYANWKMKEARLTIKDGK 160
75750409  81 RDALAIYKSWYNNPKRGRFPRVYKPTVWLTPKRSYTVDLDRMVVKITSVGELPILGYPRNLKEYANWDMKEARLTIRDGK 160
75750418 161 ALLKVTFEKEEEKVKPKDSVAVDINMNDIVVGKDDTHYVRIPTRLHDAHHFKSLAENLQKKYPRRWKQNRRILHRARSFH 240
75750409 161 AFLKVVFEKPKVKIQPKGSVAVDINMSEIVVGKDDSHYVRIPTRLHESHHFKTLAENLQKKYPRRWKENKRILHRIRSFH 240
75750418 241 QKAKLIMEDYARKVGKWVVEIAEGLGANVIKLEDLKNLIKDVNKLPAEFRDKLYLMQYRRIQYWIEWQAKKHGMIVEFVN 320
75750409 241 HKAKLIMEDFARKVGKWVVEIAWDLGANVIKLENLKNLIRNVNKLSAEFRDKLYLMQYHRIQYWIEWQARKHGMNVEYVN 320
75750418 321 PSYSSVSCPKCGHKMVEIAYRYFHCPSCGYENDRDVIAIMNLNGRGSLTLSTAPQMRDVAPNR 383
75750409 321 PSYSSVSCPKCGRKMVEIAHRYFHCPSCGYENDRDVIAIMNLNGRGSLTLSTAPQMRDVIPNR 383
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap