Conserved Protein Domain Family
PHA02940

?
PHA02940: PHA02940 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165250
View PSSM: PHA02940
Aligned: 3 rows
Threshold Bit Score: 376.974
Threshold Setting Gi: 51980137
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51980141   1 MSQVKINNKVDLILKIQENIKDLTQFKDDFG-THYTVNSLASDLKIIWKEiERKNFTSKSVQRAIELTLSILEGvYYDEV 79 
51980136  10 TSQNMGDKLIELREKIKEYIEDLEDLRHDYDlPDFDADDLRAELEYISKE-AKDAELPASVKEVIELAASALDE-QLEKA 87 
51980137  10 TQGANQDK---LKEKIGKYIKDLEDLKLGYDiND------------IQEEiVESYSITKGVKEALKVTYAILTD-YYNDA 73 
51980141  80 REHAAVLSVAFKKNfDARSAFMRVLDIYANLRAMQALYEFINEN-IKInADFVNTDIITFTQKAFDTLTTIADYYIQYGN 158
51980136  88 LKNGKALQSAYYNN-GIHDMFLNAVKLYANLKTINTIVQYIKQY-VKV-LGITEANLERFTQEAGSIIAILANHIAQHVK 164
51980137  74 KEKSKLLSDAYNKN-AIKSMFDNAIELYADLAAINALLRLMRSFkIEPePTLTTPLFIDFASKAKDTVILLIGRYVKDVK 152
51980141 159 IDKRQvlAEELDKYLSPYYDMIENSHEyLEGDIDEITAMLEANEDLARGTYNVLAAAIDKMWEHYNKGITFANRARLVLe 238
51980136 165 LSEDD--ARDLENELIYFHDLAENEPD-VDDALKEIEDDLENDTELRRGTYRALMKVLDAMQEHGKKGVGYGNGADEIM- 240
51980137 153 KDDRRtiINKISKELSWTISYQNK----LESDFKAYEEEFEEKDDISAGEYKVLKRALKLIKYYYWFGIRLAKETKAMIk 228
51980141 239 KEAWNEEEQQIDVEKVDFNAIAQNLIEAYAEFKALQAFYDVLCNDTyeLCFDDFQTHLDEALKNAKEALRLIAESYMIS 317
51980136 241 YDAYDADEEEYKPDEIDTETLLLNLAETYAHFTALQALYKNIINDY--ITNETLEDAVEVALNRAKAAIGIILNGYNNN 317
51980137 229 RDG----------KNVNMRKIAWKLTETYATMTISFALHDILCSDKydVCYKWFNYILLFPTEDVKDAIEVIREHALRD 297
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap