Conserved Protein Domain Family
PHA02938

?
PHA02938: PHA02938 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165248
View PSSM: PHA02938
Aligned: 3 rows
Threshold Bit Score: 487.544
Threshold Setting Gi: 51980150
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51980147   1 MAYLRFPMRISLLNKVNEEAARLNVKRTLLLRAAIHAFIENPPETIQPLPTPIGGFgrKESIKVFLTLPKDTLEKIRSYA 80 
51980148   1 MAYLHLYLHKSLLKKVKKEASRLNVKRKLLMSAAIQAFVENPPETINLPPDLNNGF--ELTIGVTLELPTDVVEKIYSYA 78 
51980150   1 MKSLEFIIPNALFDKIKEEAERLNVTDKLLIKAAIITFAENPSDAIKPLS---YNYskKDLTRIYLSVPKDIIEKIRLYS 77 
51980147  81 AARGLSIRNVAEKAVADFLNLSDEQKLIYINKEMERLAEKRKGKIDEESTLQLLEPEASKDPSLLVPTSFKCVDDLHKLL 160
51980148  79 MSKGLSAKKVAEIAITTFLSLSDEQKMIYIDKEIKRLEEKRKRKLSEERKFQFLESIASKDPSRSVRISFNCVDDLHKLL 158
51980150  78 SSKGFSIRRIVWSMVDDFLTLDDEKKKFYIDKVKRRLSRFRD---DQNRLTKLQEAIAYENFNAPISASFKCNPQLYKLI 154
51980147 161 AKEACERGTTASELVRRAVEEFLKKYGDNLEEIKKLYEVAKDLYYMEVEDKTCTLKIPVYMTVQLAKIANKMNVPKSALI 240
51980148 159 VKEAHVRGTTASELVRRAIEEFLQNYYKGKIKIRKLYEATKDSHYSKAGGKVYDLKVPTYMLLHLMVIADNVKLSVAMLI 238
51980150 155 EDEVIKKRTTISDLVRQAIEEFLKKYGNNYEEIKKLHETANQLFPEKGPWKGRAIKLPAYMLLQLTKISEQTSVPRSAII 234
51980147 241 RLAIVKYLNLSDTKPQKHTKpqkhiiFKCAASLVSMLEEKSKKANTAKAAIVREAVKQL-------------LQHSADEI 307
51980148 239 RLAIMRYLKLVDIEPLKQVS------FSCAASLILMLEEEVKKTNTARDAIIKEAVKQL-------------LQHSVDEI 299
51980150 235 RLAIMKHMNLLNKSTIEQQKvtrnevLNDPPNDPPSNDPPQQNNKDELEQVIRFVNVSLpdplynllkkyvmLKYNIDDE 314
51980147 308 RELSRR------------------NPACSADYLVSVMLPESLNTQLDIIAEKVRTTKNDLMRTAL--------------- 354
51980148 300 RELSRG------------------TPPYSSGYEVSVKLPESLITQLDAIAEKIRTSRSNLIRTAL--------------- 346
51980150 315 RQIKLEvskivakvliqwarrrffKRPDIETYVIWQKILEELKTSLYPSLSRGTVVKKQDIQDAMkeikdvknitelfek 394
51980147 355 -------------AVYFRLV 361
51980148 347 -------------AVYFRLV 353
51980150 395 fkrrgylkeidkdNVKILLL 414
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap