Conserved Protein Domain Family
PHA02937

?
PHA02937: PHA02937 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165247
View PSSM: PHA02937
Aligned: 3 rows
Threshold Bit Score: 279.157
Threshold Setting Gi: 51980127
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
51980131   1 MFESLFQIR--KKISGEIDEQHIKIYKLVKQVNEAVTQILNEKIKISKD--LARIVETNVEDLKDLVDKYLTMIRDHVDA 76 
51980127   1 MAQTLIKTPaaKKKGDKIEKQYIKLYKLLKQVKGEVENLILSKANKTRDakTQEYLDYNVNYVNNWIRVYMKDLREYLKE 80 
51980133   1 MTQPLNQ----PLDEGAIEKQYMYFFELGNQLREVVEQTLSVKTGTNKS--LEKAITHNIKLIKSLIKDYQMALKD--KE 72 
51980131  77 DfcnfcdwiDPDK------HLLYLTHIEAGLKIYGFLTKNDILKAILKIYKLEDEIYKTTGLMYilvdSAENDRLKIIQK 150
51980127  81 D--------EADRvpeiiiHLVYPARIHAGLILYAMLSGKDINKVMPKLTELKINGYKAATYIY----NKNKVDINLINK 148
51980133  73 GkydfwgwiEPDR------HLEYLARINAALKIYTMLTSDNAAQVRQKLNELEGEVYSTLNLIYntivNEKKDRINIIQK 146
51980131 151 IINDDRK-YVNKAINNIKTI----LSRLENVDISDKTIKMLINNIIEEAKKLQEELEKFKS--EKIEITSINDIVMFIKK 223
51980127 149 ILKENAEiKFNNALEILSKIeketKIMIEFRLVKDEKAKSFLYVLLDLAKILMKKIQNEREniNTINITNASDIILYLKH 228
51980133 147 IISKKAKaHVKEALIENNTTi--cKLKVVSANVQDETIKMLLNIAFEDAKNLEQELINFRN--EKIEITSVNDVMTFLKK 222
51980131 224 ISRLLEQSALVAMLIELIYAKDEQvheklsiqyladqayeslLLIVEDLRGEYITryervieicaNEKLAKYHTLECREI 303
51980127 229 YSQLLIDIELFTHLANAIDEIEKD------------------LRILELYRSDKIE----------ESMIGLIYAIDIPRL 280
51980133 223 IGKLLELSAVIIIIGWLLEDVDEDfaaetdleslagftdvklLLLAEDLRGREIDnyewfmrtcaDEELSKIYVNECKSL 302
51980131 304 NETE 307
51980127 281 REYQ 284
51980133 303 NS-- 304
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap