Conserved Protein Domain Family
PHA02934

?
PHA02934: PHA02934 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165245
View PSSM: PHA02934
Aligned: 7 rows
Threshold Bit Score: 355.102
Threshold Setting Gi: 22164630
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22164630    1 MDNSILSMFMYnivdngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidn 80 
113195218   1 MDNSMLPMFMC--------------------------------------------------------------------- 11 
66275837    1 ----MLSMFMC--------------------------------------------------------------------- 7  
9627546     1 MYNSMLPMFMC--------------------------------------------------------------------- 11 
18640270    1 MDNSMLPMFIC--------------------------------------------------------------------- 11 
20178415    1 MDNSMLSMFMY--------------------------------------------------------------------- 11 
17974946    1 ----MLSMFMY--------------------------------------------------------------------- 7  
22164630   81 givqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdidNGIVQDIDn 160
113195218  12 -----------------------------------------------------------------------NNIVDYVDd 20 
66275837    8 -----------------------------------------------------------------------NNIVDYVD- 15 
9627546    12 -----------------------------------------------------------------------NNIVDDID- 19 
18640270   12 -----------------------------------------------------------------------NNIVDYVDd 20 
20178415   12 -----------------------------------------------------------------------NNIVDYVD- 19 
17974946    8 -----------------------------------------------------------------------NNIIDYVH- 15 
22164630  161 givqdidngivqdidngivqdidngivqdidngivqdidngivqdidngivqdiDNGIVQDIDNGivqdIDNGIVQDIDN 240
113195218  21 diddiddiddiddiddiddiddiddiddiddiddiddiddiddiddiddiddidDIDDIDDIDDI----DDIDDIDDIDD 96 
66275837      --------------------------------------------------------------------------------    
9627546    20 ------------------------------------------------------DIDDIDDIDDI----DDIDDIDDIDD 41 
18640270   21 iddiddiddid-------------------------------diddiddiddidDIDDIDDIDDI----DDIDDIDDIDN 65 
20178415   20 -----------------------------------------------------------DDVDDG----IDNGIVPDIDN 36 
17974946      --------------------------------------------------------------------------------    
22164630  241 giVQ----DIDNGIVQDIEDKASDNDDHNYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVQYYMGKQRLDDLYRQLP 316
113195218  97 --ID----DIDNDIVQDIEDEASNNDDHNYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLP 170
66275837   16 --------DIDNGIVQDIEDEASNNVDHDYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVRYYMSKQRLDDLYRQLP 87 
9627546    42 --ID----DIDD--IDDIEDKASNN-DHNYVYPLPENMVYRFNKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLP 112
18640270   66 giVQdivhDIDNSIVQDIEDEASNNDDHNYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLP 145
20178415   37 giVP----DIDNGIVPDIEDEASDNDDHNYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYRQLP 112
17974946   16 --------------VHDIEDEASDNDDRDYVYPLPENMVYRFDKSTNILDYLSTERDHVMMAVQYYMSKQRLDDLYGQLP 81 
22164630  317 TKTRSYIDIINMYCDKVNNDYSRDINIMCDdiAASTESFTVYDINNKVNTILMDNKGLGVRLITISFITKLGRRCMNPVE 396
113195218 171 TKTRSYIDIINMYCDKVNNDYNREMNIMYD--MASTESFTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVE 248
66275837   88 TKTRSYIDIINIYCDKVSNDYNRDMNIMYD--MASTKSFTVYDINNEVNTILMDNKGLGVRLATISFITELGRRCMNPVE 165
9627546   113 TKTRSYIDIINTYCDKVNNDYNRDMNIMYD--MASTESFTVYDINNEVNTILMDNKGLGVRLATISFITELGKRCMNPVE 190
18640270  146 TKTRSYIDIINMYCDKVNNDYNRDMNIMYD--MASTESFTVYDINNEVNTILIDNKGLGVRLATISFITELGRRCMNPVE 223
20178415  113 TKTRSYIDIINMYCDKVNNDYNRDMNIMYD--MASTESFTVYDINNEVNTILIDNKGLGVRLATISFITELGRRCMNPVE 190
17974946   82 TKTRSYVDIINTYCDKVNNDYNSDMNIMCD--MASTESFTVYDINNEVNTILMNNKGLGVRLATISFITELGRRCMNPVE 159
22164630  397 TIKMFTLLSHTICDDYFVDYITDIFSTPRDNATTSTREYLKLMGIAVIMFATYKTLKYMI 456
113195218 249 TIKMFTLLSHTICDDCFVDYITDISPQDNTIPNTSTREYLKLIGITAIMFATYKTLKYMI 308
66275837  166 TIKMFTLLSHTICDDYFVDYITDISPPDNTIPNTSTREYLKLIGITAIMFATYKTLKYMI 225
9627546   191 TIKMFTLLSHTICDDCFIDYITDISPPDNTIPNISTREYLKLIGITAIMFATYKTLKYMI 250
18640270  224 TIKMFTLLSHTICDDCFVDYITDISPPNNTISNTSTREYLKLIGITAIMFATYKTLKYMI 283
20178415  191 TIKMFTLLSHTICDDCFVDYITDISPPDNTIPNTSTREYLKLIGITAIMFATYKTLKYMI 250
17974946  160 TIKMFTLLSHTICDDYFVDYITYISTPRDNAIH-STREYLKIMGIAVIMFATYKTLKYMI 218
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap