Conserved Protein Domain Family
PHA02933

?
PHA02933: PHA02933 
unchracterized protein; Provisional
Statistics
?
PSSM-Id: 165244
View PSSM: PHA02933
Aligned: 6 rows
Threshold Bit Score: 246.844
Threshold Setting Gi: 113195217
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17974945    1 METKSDYEDAVFYFVDDDEICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELIKFDDAAIRYYGIDKINEIVEAM 80 
20178414    1 MATKSDYEDAVFYFVDDDELCSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMKFDDVAIRYYGIDKINEIVETM 80 
18640269    1 MATKSDYEDAVFYFV-DDEICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMKFDDAAIRYYGINKINEIVEAM 79 
9627545     1 MATKSDYEDAVFYFVDDDEICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMKFDDAAIRYYGIDKINEIVEAM 80 
66275836    1 MATKLDYEDAVFYFVDDDKICSRDSIIDLIDEYITWRNHVIVFNKDITSCGRLYKELMKFDDVAIRYYGIDKINEIVEAM 80 
113195217   1 MATKSDYEDAVFYFV-DDEICSRDSIIDLIDEYITWRNHLIVFNKDITSCGRLYKELMTFDDVAIRYYCIDKINEIVEAM 79 
17974945   81 SEGDHYINLTEVHDQESLFATIGICAKIAEHWGYKKISESKFQSLGNITDLMTDDNINILILFLEKKLN 149
20178414   81 SEGDHYINLTEVHDQESLFATIGICAKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKKLN 149
18640269   80 SEGDHYINLTEVHDQESLFATIGICAKITEHWGYKKISESRFQSLGNITDLITDDNINILILFLEKN-- 146
9627545    81 SEGDHYINLTEVHDQESLFATIGICAKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKKLN 149
66275836   81 SEGDHYINFTKVHDQESLFATIGICAKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKKLN 149
113195217  80 SEGDHYINLTEVHDQESLFATIGICAKITEHWGYKKISESRFQSLGNITDLMTDDNINILILFLEKN-- 146
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap