Conserved Protein Domain Family
PHA02930

?
PHA02930: PHA02930 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165241
View PSSM: PHA02930
Aligned: 7 rows
Threshold Bit Score: 110.855
Threshold Setting Gi: 18640276
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
22164635   1 MTLVMGSCCGRFRDAkNKNKNKKEDVEEGGEGCYDYKNLNDLDEfNTRVEFGPLYMINEEKSDINTLDIKRRYRHAIESV 80 
113195224  1 MTLVMGSCCGRFCDAkNKNKFKKEDIEEEGEGCYDYKNLNDLDE-ETRIEFGPLYMINKEKSDINTLDIKRRYRHAIESV 79 
66275843   1 MTLVMGSCCGRFCDA--KNKNKKEDVEEGREGCYNYKNLNDLDEsEARVEFGPLYMINEEKSDINTLDIKRRYRHTIESV 78 
9627552    1 MTLVMGSCCGRFCDA--KNKFKKDDIEEEGEGYCDYKNLNDLDE-ATRIEFGPLYIINEEKSDINTLDIKRRYRHAIESV 77 
18640276   1 MTLVMGSCCGRFCDAkNKNKFKKEDIEEEGEGCYDYKNLNDLDE-DTRIEFGPLYMINEEKSNKYI-----GYKKKI--- 71 
20178421   1 MTLVMGSCCGRFCDK-NKNKNKKEDVEAGGEGYYDYKNINDLDEfEARVEFGPLYMINEEKSDINTLDIKRRYRHTIESV 79 
17974952   1 ----MGSCCGRFCDA----KNKKEDVEDGREGCCDYKNLNDLDEsEARVEFGPLYMINEEKSDINTLDIKRRYRHTIESV 72 
22164635  81 YF 82 
113195224 80 YF 81 
66275843  79 YF 80 
9627552   78 YF 79 
18640276     --    
20178421  80 YF 81 
17974952  73 YF 74 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap