Conserved Protein Domain Family
PHA02928

?
PHA02928: PHA02928 
Hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165239
View PSSM: PHA02928
Aligned: 4 rows
Threshold Bit Score: 360.877
Threshold Setting Gi: 17974935
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627536    1 MIMSTDPNNILMRYLKNLTDDKFKCIIHQSSDFLYLSDRDYTSITKETLVSEIVEEYPDDCNKILAIIFLVLDKDIDVDI 80 
66275824  18 MIMSTDPNNILMRHLKNLTDDEFKCIIHRSSDFLYLSDSDYTSITKETLVSEIVEEYPDDCNKILAIIFLVLDKDIDVDI 97 
20178404  20 MIMSTDPNNILMRHLKNLTDDEFKCIIHRSSDFLYLSDRDYTSITKETLVSEIVEEYPDDCNKILAIIFLVLDKDIDVDI 99 
17974935   1 MIMRTDTNNILMRHLKNLTDDEFKCIIHRSSDFLYLSDRDYTSITKETLVSEIVEEYPDDCNKILAIIFLVLDKDIDVDI 80 
9627536   81 DIETklKPKPAVRYAILDKMTKDIKLTDLVRHYFRYIEQDIPLGPLFKKIDSYRIRAINKYSKELGLATEYFNKYGHLMF 160
66275824  98 KTKL--KPKPAVRFAILDKMTEDIKLTDLVRHYFRYIEQDIPLGPLFKKIDSYRTRAINKYSKELGLATEYFNKYGHLMF 175
20178404 100 ETKL--KPKPAVRFAILDKMTADIKLTDLVRHYFRYIEQDIPLGPLFKKIDSYRIRAINKYSKELGLATEYFNKYGHLMF 177
17974935  81 ETKLtpTPKPAVRFAILDKMTADIKLTDLVRHYFRYIEQDIPLGPLFKKIDSYRIRAINNYSKELGLATEYFNKYGHLMF 160
9627536  161 YTLPIPYNRFFCRNSIGFLAVLSPTIGHVKAFYKFIEYVSIDDRRKFKKELMSK 214
66275824 176 YTLPIPYNRFFCRNSIGFLAVLSPTIGHVKAFYKFIEYVSIDDRRKFKKELMSK 229
20178404 178 YTLPIPYNRFFCRNSIGFLAVLSPTIGHVKAFYKFIEHVSIDDRRKFKKELMSK 231
17974935 161 YTLPIPYNRFFCRNSIGFLAVLSPTIGYVKAFYKFIEYVSIDDRRKFKKELMSK 214
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap