Conserved Protein Domain Family
PHA02926

?
PHA02926: PHA02926 
zinc finger-like protein; Provisional
Statistics
?
PSSM-Id: 165237
View PSSM: PHA02926
Aligned: 6 rows
Threshold Bit Score: 416.771
Threshold Setting Gi: 22164619
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
9627525     1 MEFDPTKINISSIDHVTILQYIDEPNDIRLTVCIIQNINNITYYINITKINPHLANQFRAWKKRIAGRDYMTNLSRDTGI 80 
18640247    1 MEFDPSKINISSIDHVTILQYIDEPNDIRLTVCIIQNINNITYYINITKINPHLANQFRAWKKRIAGRDYMTNLSRDTGI 80 
20178391    1 MEFDPTKINISSIDHVTILQYIDEPNDIRLTVCIIQNINNITYYINITKINPHLANQFRTWKKRIAGRDYMTNLSRDTGI 80 
22164619    1 MEFDPAKINTSSIDHVTILQYIDEPNDIRLPVCIIRNINNITYFINITKINPDLANQFRAWKKRIAGRDYMTNLSRDTGI 80 
17974921    1 MEFDPVKINTSSIDHVTILQYIDEPNDIRLTVCIIRNINNITYYINITKINPHLANRFRAWKKRIAGRDYMTNLSRDTGI 80 
113195193   1 MEFDPTKINISSIDHVIILQYIDEPNDIRLTVCIIQNINNITYYINITKINPHLANQFRAWKKRIAGRDYMTNLSRDTGI 80 
9627525    81 QQSNLTETIRNCQKNRNIYGLYIHYNLVINVVIDWITDVIVQSILRGLVNWYIDNNTYTPNTPNNTTTISELDIIKILDK 160
18640247   81 QQSNLTETIRNCQKNRNIYGLYIHHNLVINLVIDWITDVIVQSIVRGLVNWYIDNNTYTPNTPNNTTTISELDIIKILDK 160
20178391   81 QQSKLTETIRNCQKNRNIYGLYIHYNLVINVVIDWITDVIVQSILRGLVNWYIANNNYTPNTPNNTTTISELDIIKILDK 160
22164619   81 QQSKLTETIRNCQKNRNIYGLYIHYNLVINVVIDWITDVIVQSILRGLVNWYIANNTYNPNTP-NSTTISELDIIKILDK 159
17974921   81 QQSKLTETIRNCQKNKNIYGLYIHYNLVINVVIDWITDVIVQSILRGLVNWYIANNTYTPNTPNNTTTISELDIIKILDK 160
113195193  81 QQSNLTETIRNCQKNRNIYGLYIHHNLVINLVIDWITDVIVQSILRGLVNWYIDNNTYTPNTPNNTTTISELDIIKILDK 160
9627525   161 YEDVYKVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFRNITMSKFYKL 240
18640247  161 YEDVYRVSKEKECGICYEAVYSKRSENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFRNITMSKFYKL 240
20178391  161 YEEVYRVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFRNITMSKFYKL 240
22164619  160 YEDVYRVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGASDNCPICRTRFRNITMSKFYKL 239
17974921  161 YEDMYRVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRRETGALDNCPICRTRFRKITMSKFYKL 240
113195193 161 YEDVYRVSKEKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRIETGASDNCPICRTRFRNITMSKFYKL 240
9627525   241 VN 242
18640247  241 VN 242
20178391  241 VN 242
22164619  240 VN 241
17974921  241 VN 242
113195193 241 VN 242
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap