Conserved Protein Domain Family
PHA02923

?
PHA02923: PHA02923 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165235
View PSSM: PHA02923
Aligned: 11 rows
Threshold Bit Score: 427
Threshold Setting Gi: 20178390
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275807    9 LQTIKLFNN-EFDCIRNDIRELFKHV---TDSDSIQLPMEDNSDIIENIRKILYRRLKNVECVDIDSTITFMKYDPNDDn 84 
66275821    1 MDTIKIFNHgEFDTIRNELVNLLKVVkwnTINSNVTVSSTDTIDISDCIREILYKQFKNVRNIEVSSDISFIKYNRFND- 79 
66276006    9 LQTIKLFNN-EFDCIRNDIRELFKHV---TDSDSIQLPMEDNSDIIENIRKILYRRLKNVECVDIDSTITFMKYDPNDDn 84 
9627524     9 LQTIKLFNN-EFDCIRNDIRELFKHV---TDSDSIQLPMEDNSDIIENIRKILYRRLKNVECVDIDSTITFMKYDPNDDn 84 
9627532     1 MDTIKIFNHgEFDTIRNKLVNLLKVVkwnTINSNVTVSSTDTIDISNCIREILYKQFKNVRNIEVSSNISFIKYNRFND- 79 
18640256    1 MDTIKIFNHgEFDTIRNELVNLLKVVkwnTINSNVTVSSTDTIDISDCIREILYKQFKNVRNIEVSSDISFIKYNKFND- 79 
20178401    1 MDTIKIFNHgEFDTIRNELVNLLKVVkwnTINSNVTVSSTDTIDISDCIREILYKQFKNVRNIEVSSDISFIKYNRFND- 79 
20178390    9 LQIIKLFNN-EFDCVRNDIRELFKHV---TDSDSIQLPMEDKSDIIENIRKILYRRLKNVECVDIDNTITFMKYDPNDDy 84 
22164618    9 LQTIKLFNN-EFDCIRNDIRELFKHV---TDFDSIQLPMEDNSDIIENIRKILYRRLKNVECVDIDNTITFMKYDPNDDn 84 
17974929    1 MDTIKIFNHgEFDTIRNELVNLLKVVkwnTINSNVTVSSTDTIDISDCIREILYKQFKNVRNIEVSSDISFIKYNRFND- 79 
113195202   1 MDTIKIFNHgEFDTIRNELVNLLKVVkwnTINSNVTVSSTDTIDISDCIREILYKQFKNVRNIEVSSDISFIKYNRFND- 79 
66275807   85 krtcsnwVPLTNNYMEYCLVIYLETPICGGKIKLYHPTGNIKSDKDIMFAKTLDFKSKKVLTGRKTIAVLdISVSYNRSM 164
66275821   80 -------TTLTDDNVGYYLVIYLNRTKSVKTLIYPTPETVITSSEDIMFSKSLNFRFENVKRDYKLVMCS-ISLTYKPSI 151
66276006   85 krtcsnwVPLTNNYMEYCLVIYLETPICGGKIKLYHPTGNIKSDKDIMFAKTLDFKSKKVLTGRKTIAVLdISVSYNRSM 164
9627524    85 krtcsnwVPLTNNYMEYCLVIYLETPICGGKIKLYHPTGNIKSDKDIMFAKTLDFKSKKVLTGRKTIAVLdISVSYNRSM 164
9627532    80 -------TTLTDDNVGYYLVIYLNRMKSVKTLIYPTPETVITSSEDIMFSKSLNFRFENVKRDYKLVMCS-ISLTYKPSI 151
18640256   80 -------TTLTDDNVGYYLVIYLNRTKSVKTLIYPTPETVITSSEDIMFSKSLNFRFENVKRDYKLVMCS-ISLTYKPSI 151
20178401   80 -------TTLTDDNMGYYLVIYLNRTKSVKTLIYPTPETVITSSEDIMFSKSLNFRFENVKRDYKLVMCS-ISLTYKPSI 151
20178390   85 krtcsnwVPLTNNYMEYCLVIYLETPICGGKIKLYHPTGNIKSDKDIMFAKTLDFKSKKVLSGRTTIAVLdISISYRKLM 164
22164618   85 krtwsnwAPLTNNYMEYCLVIYLETPICGGKIKLYHPTGNITSDKDIMFAKTLDFKSKKVLTGRKTIAVLdISVSYNRSM 164
17974929   80 -------MTITDDNMGYYLVIYLNRTKSLKTLIYPTLETVISSSEDIMFSKSLNFRFENTKREYKLVMCS-ISLIYKPSI 151
113195202  80 -------TTLTDDNVGYYLVIYLNRTKSVKTLIYPTPETVITSSEDIMFSKSLNFRFENVKLDYKLVMCS-ISLTYKPSI 151
66275807  165 TTIHYNDDVDIDIHTDKNGKELCYCYITIDDHYLVDVETIGVIVNRSGKCLLVNNHLgiGIVKDKRISDSFGDVCMDTIF 244
66275821  152 CRIQYDNNKYLDISDSQECNNLCYCVITMDPHHLIDLETICVLVDKSGKCLLVNEFY--IRFRKNHIYNSFADLCMDHIF 229
66276006  165 TTIHYNDDVDIDIHTDKNGKELCYCYITIDDHYLVDVETIGVIVNRSGKCLLVNNHLgiGIVKDKRISDSFGDVCMDTIF 244
9627524   165 TTIHY-GDVDIDIHTDKNGKELCYCYITIDDHYLVNVETIGVIVNRSGKCLLVNNHLgiGIVKDKRISDSFGDVCMDTIF 243
9627532   152 CRIQYDNNKYIDISDSQEGNNLCYCVITMDPHHLIDLETICVLVNKSGKCLLVNEFY--TRFRKNHIYDSFADLCMDHIF 229
18640256  152 YRIQYDNNKYIDISDSQEGNNLCYCVITMDPHHLIDLETICVLVDKSGKCLLVNEFY--TRFRKNHIYNSFADICMDHIF 229
20178401  152 CRIQYDNDKYIDISDSQEGNNLCYCVITMDPHHLIDLETMCVLVDRSGKCLIVNEYN--TRFRKHHIYDSFTDLCIDHIF 229
20178390  165 TTIHYNDDVDIDIHTDKNGKELCYCYITIDDHYLVDVETIGVIVNRSGKCLLVNNHLgiGIVKDKRISDSFGDVCMDTIF 244
22164618  165 TTIHYNDDVDIDIHTDKNGKELCYCYITIDDHYLVDVETIGVIVNRSGKCLLVNNHLgiGIVKDKRISDSFGDVCMDTIF 244
17974929  152 CRIQYDNNKYIDISDSQEGNNLCYCVITMDPHHLIDLETMCVLVDKSGKCLLVNEFY--IRFRKNHIYNSFVDICMDHIF 229
113195202 152 YRIQYDNNKYIDISDSQEGNNLCYCVITIDPHHLIDLETICVLVDKSGKCLLVNEFY--TRFRKNHIYNSFADLCMDHIF 229
66275807  245 DFSEARELFSLTNDDNRNIAWDTDKLDDDTDIWTPVTEDDYKFLSRLVLYAKSqSDTVFDYYVLTGDTEPPTVFIFKVTR 324
66275821  230 ELPNTKELFTLRNDDGRNIAWDNDKLESGNNTWIPKTDDEYKFLSKLMNIAKF-NNTKFDYYVLVGDTDPCTVFTFKVTK 308
66276006  245 DFSEARELFSLTNDDNRNIAWDTDKLDDDTDIWTPVTEDDYKFLSRLVLYAKSqSDTVFDYYVLTGDTEPPTVFIFKVTR 324
9627524   244 DFSEARELFSLTNDDNRNIAWDTDKLDDDTDIWTPVTEDDYKFLSRLVLYAKSqSDTVFDHYVLTGDTEPPTVFIFKVTR 323
9627532   230 ELPDTEELFTLRNDDGRNIAWDNDKLESGNNTWIPKTDDEYKFLSKLMNIAKF-NNTKFDYYMLVGDTDPCTVFTFKVTK 308
18640256  230 ELPDTEELFTLCNDDGRNIAWDNDKLESGNNTWIPKTDDEYKFLSKLMNIAKF-NNTKFDYYMLVGDTDPCTVFTFKVTK 308
20178401  230 ELPNTEELFTLRNDDGRNIAWDNDKLESGNNTWIPKTDEEYKFLSKLMNIAKF-NNTKFDYYVLVGDTDPCTVFTFKVTK 308
20178390  245 DFSEARELFSLTNNDNRNIAWDTDKLDDDTDIWTPVTEDDYNFLSRLVLYAKSqSDTVFDYYVLTGDTEPLTVFNFKVTR 324
22164618  245 DFSEARELFSLTNDDNRNIAWDTDKLDDDTDIWTPVTEDDYKFLSRLVLYAKSqSDTVFDYYVLTGDTEPPTVFNFKVTR 324
17974929  230 ELPNTKELFTLYNDDGRNIAWDNDKLESNNT-WIPKTDDEYKFLSKLMNIAKF-NNTKFDYYVLVGDTDPCTVFTFKVTK 307
113195202 230 ELPDTEELFTLRNDDGRNIAWDNDKLESGNNTWIPKTDDEYKFLSKLMNIAKF-NNTKFDYYMLVGDTDPCTVFTFKVTK 308
66275807  325 FYFNMPK 331
66275821  309 YYINLNY 315
66276006  325 FYFNMPK 331
9627524   324 FYFNILK 330
9627532   309 YYINLNY 315
18640256  309 YYINFNY 315
20178401  309 YYINLNY 315
20178390  325 FYFNMLK 331
22164618  325 FYFNMLK 331
17974929  308 YYININY 314
113195202 309 YYINLNY 315
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap