Conserved Protein Domain Family
PHA02922

?
PHA02922: PHA02922 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165234
View PSSM: PHA02922
Aligned: 5 rows
Threshold Bit Score: 278.064
Threshold Setting Gi: 9627522
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
17975098   1 MAFPCAQFSPCHCHATKDSLNTVTDVRHCLTEYILWVSHRWTHRESAGPLYRLLISFRIDAMELFGSELKEFSDSLPWDN 80 
20178581   1 MASPCPQFTPCHCHATKDSLNTVDDIKHCLTEYILWVSHRWTHRETAGSLYRLLISYRTDATELFGSELKEFSDSLPWDN 80 
18640239   1 MASPCAQFSPCHCHATKDSLNTVADVRHCLTEYILWVSHRWTHRESAGSLYRLLISFRTDATELFGSELKEFSDSLPWDN 80 
9627522    1 MASSCAQFSPCHCHATKDSLNTVADVRHCLTEYILWVSHRWTHRESAGSLYRLLISFRTDATELFGSELKEFSDSLPWDN 80 
30844338   1 MASPCPQFTPCHCHATKDSLNTVDDIKHCLTEYILWVSHRWTHRETAGSLYRLLISYRTDATELFGSELKEFSDSLPWDN 80 
17975098  81 IDNCVEIIKCFIRNDSMKTAKELCAIIGLCTQSAIVTGRVFNDKYIDILLMLRKILNENDYLTLLDHILTAKY 153
20178581  81 IDNCVGIINCFIRNESMKTAKELRAIIGLCTQSAIVSGRVFNDKYIDILLMLRKILNENDYLTLLDHIRTAKY 153
18640239  81 IDNCVEIIKCFIRNDSMKTAKELRAIIGLCTQSAIVSGRVFNDKYIDILLMLRKILNENDYLTLLDHIHTAKY 153
9627522   81 IDNCVEIIKCFIRNDSMKTAKELCAIIGLCTQLAIVSGRVFNDKYIDILLMLQKILNENDYFTLLDHIRTAKY 153
30844338  81 IDNCVGIINCFIRNESMKTAKELRAIIGLCTQSAIVSGRVFNDKYIDILLMLRKILNENDYLTLLDHIRTAKY 153
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap