Conserved Protein Domain Family
PHA02920

?
PHA02920: PHA02920 
putative virulence factor; Provisional
Statistics
?
PSSM-Id: 165233
View PSSM: PHA02920
Aligned: 7 rows
Threshold Bit Score: 199.457
Threshold Setting Gi: 22164626
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
66275825    1 MRTLLIRYILWRNDNDQTYYNDDFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVA 80 
9627537     1 MRTLLIRYILWRNDGDPSYYNDDFEKLMLLDELVDDSDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVA 80 
22164626    1 MRTLLIRYILWRNDGDPSYYNDDFKKLMLFDELVDDDDVYTLIKKMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVA 80 
18640260    1 MRTLLIRYILWRNDGDPSYYNDDFKKLMLLDELVDDGDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVA 80 
20178405    1 MRTLLIRYILWRNDGDPSYYNDDFKNLMSLDELVDDGDVCALIKNMRMTLSDGPLLDRLNQPVNNIEDAKRMIAISAKVA 80 
17974936    1 MRTLLIRYILWRNDGDPSYYNDDFKKLILFDELVDDDDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDVKRMIAISAKVA 80 
113195207   1 MRTLLIRYILWRNDGDPSYYNDDFKKLMLLDELVDGGDVCTLIKNMRMTLSDGPLLDRLNQPVNNVEDAKRMIAISAKVA 80 
66275825   81 RDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK 117
9627537    81 RDIGERPEIRWEESFTILFRMIETYFDDLMIDLYGEK 117
22164626   81 RDIGRRSEIRWEDSFAILFRMIEKYFDDLMIDLYGEK 117
18640260   81 RDIGERSEIRWEESFTILFRMIEIYFDDLMIDLYGEK 117
20178405   81 RDIGERSEIRWEDSFAILFRMIEKYFDDLMIDLYGEK 117
17974936   81 RDIGRRSEIRWEDSFTILFRMIEKYFDDLMTDLYGEK 117
113195207  81 RDIGERSEIRWEESFTILFRMIETYFDDLMIDLYGEK 117
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap