Conserved Protein Domain Family
PHA02919

?
PHA02919: PHA02919 
host-range protein; Provisional
Statistics
?
PSSM-Id: 165232
View PSSM: PHA02919
Aligned: 7 rows
Threshold Bit Score: 249.876
Threshold Setting Gi: 18640253
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
113195199   1 MGIQHEFDIIINGDIALRNLQLHRGDNYGCKLKIISNDYKKLKFRFIIRPDWSEIDEVKGLTVFANNYAVKVNKVDDTFY 80 
17974926    1 MGIQHEFDIIINGDIALRNLQLHRGDNYGCKLKIISNDYKKLKLRFVIRPDWSEIDEVKGLTVFANNYAVKVNKVDYTLY 80 
20178397    1 MGIQHEFDIIINGDIALRNLQLHKGDNYGCRLKIISNGYKQLKFRFIIRPDWSEIDDVKGLTVFANNYAVKVNKVDDTFY 80 
18640253    1 MGIQHEFDIIINGDIALRNLQLHRGDNYGCKLKIISNDYKKLKFRFIIRPDWSEIDEVKGLTVFANNYVVKVNKVDDTFY 80 
22164622    1 MGIQHEFDIVINGDIALRNLQLRRGDNYGCKLKIISNDYKKLKFRFIIRPDWSEINEVKGLTVFSNNYAVKVNKVDDTFY 80 
9627529     1 MGIQHEFDIIINGDIALRNLQLHRGDNYGCKLKIISNDYKKLKFRFIIRPDWSEIDEVKGLTVFANNYAVKVNKVDDTFY 80 
66275818    1 MGIQHEFDIIINGDIALRNLQLHKGDNYGCKLKIISNDYKKLKFRFIIRPDWSEIDEVKGLTVFANNYAVKVNKVDDTFY 80 
113195199  81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD 150
17974926   81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKIKEENYSSPYIEHPLIPYRDYESMD 150
20178397   81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD 150
18640253   81 YVIYEAVIHLYNKKTEILIYSDDEKELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD 150
22164622   81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYIRLNMINKDYKVKEENYSSPYIEHPLIPYRDYESMD 150
9627529    81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD 150
66275818   81 YVIYEAVIHLYNKKTEILIYSDDENELFKHYYPYISLNMISKKYKVKEENYSSPYIEHPLIPYRDYESMD 150
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap