Conserved Protein Domain Family
PHA02917

?
PHA02917: PHA02917 
ankyrin-like protein; Provisional
Statistics
?
PSSM-Id: 165231
View PSSM: PHA02917
Aligned: 3 rows
Threshold Bit Score: 1187.49
Threshold Setting Gi: 113195195
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20178393    1 MFDYLENEEVALDELKQMLRDRDPNDTRNQFKNNALHAYLFNEHCNNVEVVKLLLDSGTNPLHKNWRQLTPLGEYTNSRH 80 
17974923    1 MFDYLENEEVVLDELKQMLRDRDPNDTRNQFKNNALHAYLFNEHCNNVEVVKLLLDSGTNPLHKNWRQFTPIEEYTNSRH 80 
113195195   1 MFDYLENEEVALDELKQMLKDRDPNDTRNQFKNNALHAYLFNEHCNNVEVVKLLLDSGTNPLHKNWRQLTPLEEYTNSRH 80 
20178393   81 GKVNKDIAMVLLEATGYSNINDFNIFTYMKSKNVDIDLIKVLVEHGFDFSVKCEKHHSVIENYVMTDDPVPEIIDLFIEN 160
17974923   81 VKVNKDIAMALLEATGYSNINDFNIFSYIKSKNVDVDLIKVLVEHGFDLSVKCENHRSVIENYVMTDDPVPEIIDLFIEN 160
113195195  81 VKVNKDIAMALLEATGFSNINDFNIFSYMKSKNVDVDLIKVLVEHGFELSVKCENHRSVIENYVMTDDPVPEIIDLFIEN 160
20178393  161 GCSVIYedEDDEYGYAYeeyhsqnDDYQPRNCGTVLHLYIISHLYSESDSRSCVNPEVVKCLINHGINPSSIDKNYCTAL 240
17974923  161 GCSVLY--EDDEYGYAY-------DDYQPRNCGTVLHLYIISHLYSESDTRAYVRPEVVKCLINHGIKPSSIDKNYCTAL 231
113195195 161 GCNVLYedEDDEYGYAY-------DDYQPRNCGTVLHLYIISHLYSESDTRAYVRPEVVKCLINHGIKPSSIDKNYCTAL 233
20178393  241 QYYIKSSHIDIDIVKLLMKGIDNTAYSYIDDLTCCTRGIMADYLNSDYRYNKDVDLDLVKLFLENGKPHGIMCSIVPLWR 320
17974923  232 QYYIKSSHIDIDIVKLLMKGIDNTAYLYIDDLTCCTRGIMADYLNSDYRYNKDVDLDLVKLFLENGKPHGIMRSIVPLWR 311
113195195 234 QYYIKSSHIDIDIVKLLMKGIDNTAYSYIDDLTCCTRGIMADYLNSDYRYNKDVNLDLVKLFLENGKPHGIMCSIVPLWR 313
20178393  321 NDKETISLILKTMNSDVLQHILIEYITFSDIDISLVEYMLEYGAVVNKEAIHGYFKNINIDSYTMKYLLKKEGGDAVNHL 400
17974923  312 NDKETISLILKTMNSDVLQHILIEYMTFGDIDIPLVECMLEYGAVVNKEAIHRYFRNINIDSYTMKYLLKKEGGDAVNHL 391
113195195 314 NDKETISLILKTMNSDVLQHILIEYMTFGDIDIPLVECMLEYGAVVNKEAIHGYFRNINIDSYTMKYLLKKEGGDAVNHL 393
20178393  401 DDGEIPIGHLCKSNYGRYNFYTDTYRQGFRDMSYACPILSTINICLPYLKDINMIDKRGETLLHKAVRYNKQSLVSLLLE 480
17974923  392 DDGEIPIGHLCESNYGCYNFYTYTYKKGLCDMSYTCPILSTINICLPYLKDINMIDKRGETLLHKAVRYNKQSLVSLLLE 471
113195195 394 DDGEIPIGHLCKSNYGCYNFYTYTYKKGLCDMSYACPILSTINICLPYLKDINMIDKRGETLLHNAVRYNKQSLVSLLLE 473
20178393  481 SGSDVNIRSNNGYTCIAIAINESRNIELLNMLLCHKPTLDCVIDSLREISNIVDNAYAIKQCIRYAMIIDDCISSKIPES 560
17974923  472 SGSDVNIRSNNGYTCIAIAINESRNIELLKMLLCHKPTLDCVIDSLSEVSNIVDNAYAIKQCIKYTMIIDDCTSSKIPES 551
113195195 474 SGSDVNIRSNNGYTCIAIAINESRNIELLKMLLCHKPTLDCVIDSLREISNIVNNDYAIKQCIKYAMIIDDCTSSKIPES 553
20178393  561 ISKHYNDYIDICNQELNEMKKIIVGGNTMFSLIFTDHGAKIIHRYANNPELRAYYESKQNKIYVEVYDIISNAIVKHNKI 640
17974923  552 ISQRYNDYIDLCNQELNEMKKIMVGGNTMFSLIFTEHGAKIIHRYANNPEIRAYYESKQNKIYVEAYDIISDAIVKHNKI 631
113195195 554 ISQRYNDYIDLCNQELNKMKKIMVGGNTMFSLIFTDHGAKIIHRYANNPELREYYESKQNKIYVEAYDIISNAIVKHDRI 633
20178393  641 HKN-IESVDDNTYISNLPYTIKYKIFEQQ 668
17974923  632 HKTiIESVDDNTYISNLPYTIKYKIFEQQ 660
113195195 634 HKN-IESVDDNTYISNLPYTIKYKIFEQQ 661
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap