Conserved Protein Domain Family
PHA02914

?
PHA02914: PHA02914 
Immunoglobulin-like domain protein; Provisional
Statistics
?
PSSM-Id: 165230
View PSSM: PHA02914
Aligned: 2 rows
Threshold Bit Score: 728.44
Threshold Setting Gi: 40556258
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40555952   1 MNLLKSLTLFAVFCATEsyNIYSRNGDTE-ALTCILPAAKYADKVVLIKGSKRNNTLKVesSISNAGLDTvCYCGDPDKN 79 
40556258  10 KRILASLIIYSVCVSSK--NIFLRSEEEElSPTCSLPSFTMADRVVVLRGNDMTPVKEI--SINNRGEDN-CYCGNQITE 84 
40555952  80 YTFILENVGEHHDGRFKCIFYLGKNETHRHTINVVVLPKVD-TYWYLNDQHVCYVCNITKPRNTDALKVYMVAGGVNVTN 158
40556258  85 YSISESNITLSEEGDYTCIFYLNDTVSHKHEVLVRKAPKIStTFLEFNEKYTDICCKVDNTMYQNEVKVFFVTGGVTVDG 164
40555952 159 RFL--RDFNSTPTNRVVKTCADKSYDDWARNAVCGVSYYNHLKEYnisydgtnGVNISNILSKYCPENvinskvcgdngs 236
40556258 165 NYVgkKENTNDSSRTTYYLRTDPSHINTTSEILCKVEYFGAVVSL--------AVNLSEISTRVTPIN------------ 224
40555952 237 kDSESYEDYEESGDYeesgdyseVTYNKKPKEEVMVEvGSTVELKCSLSM---ENITNAKWIETGFEIG--YGVYVVNEI 311
40556258 225 -QSNLLTNEEEEDPY--------VVYDKKKFDNYTLP-GKRVDIECFFSTcgnESISSITWYDTNYPYKplIGTVKSKDN 294
40555952 312 VSGGNAEDKSFMISAHanysKDLKNSTLTIKNVRVSNGGCYTYQVFSGKKKEECTKCFKVDTHVVFRWNYEGDNVTKVAC 391
40556258 295 VEIDFHKEDDYSIVGY----DGMLRSTLVIPKAHINNAQCYEAVASMGNFTQKCRHCLLVADQVFFKWYTTRNNETVVIC 370
40555952 392 YVGQYdMQPFsLYWKSRGVSVGGRIALDLDEHNYKVLDGYESSEIRVMGKYDRD-VSMLWCRYITYSGYIIEYPIRFFGT 470
40556258 371 YAASY-VTPI-ILWKVNGVTFTGEKTDASVFVEGAICRKCGASYIIIRDNRDKHtVKKPSCINLTGQNYAREYPIDYEKY 448
40555952 471 KEHKFHKVENqeARIVKNYW 490
40556258 449 RKNKINKLEH--YRVLTNLV 466
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap