Conserved Protein Domain Family
PHA02911

?
PHA02911: PHA02911 
C-type lectin-like protein; Provisional
Statistics
?
PSSM-Id: 177496
View PSSM: PHA02911
Aligned: 4 rows
Threshold Bit Score: 308.274
Threshold Setting Gi: 9634922
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556264   1 MERLGSYEVLESTSKLFARASSIYQKQKLAVILAVLSVILTIVIIVLLALLPKSVTYCPDDTEVVTIESSSPVTYPEPSS 80 
40555941   1 MERLGSYEVLESTSKLFARASSIYQKQKLAVILAVLSVILTIVIIVLLALLPKSVTYCPDDTEVVTIESSSPVTYPEPSS 80 
9634922    1 MKMNYPIEYYKEKMKFLRDNS-----ERYILPITCLCLTSVVITSCLFAALFVAVRDCKRDS---FLEDTTTAITTSSSI 72 
9634929    1 MKMNYPIEYYKEKMKFLRDNS-----ERYILPITCLCLTSVVITSCLFAALFVAVRDCKRDS---FLEDTTTAITTSSSI 72 
40556264  81 PVTCPEPPTVTCPEVPSPSEPICSRIWVNHMGYCVRSLGPEVKYTMENARRFCEQKDATLVKNIDEHKKFLEYVWTG--V 158
40555941  81 PVTCPEPPTVTCPEVPSPSEPICSRIWVNHMGYCVRSLGPEVKYTMENARRFCEQKDATLVKNIDEHKKFLEYVWTG--V 158
9634922   73 ATTYRDNLVIHCP-----------RDWISHNGICLLSTGEKVGFRQGIQK--CEKLGSDMIGKSEEEMKALKNIWTGndH 139
9634929   73 ATTYRDNLVIHCP-----------RDWISHNGICLLSTGEKVGFRQGIQK--CEKLGSDMIGKSEEEMKALKNIWTGndH 139
40556264 159 TSYWIDSRESGV-------CLIGTQNHIPEYPEVRKVSCDERHSFICIKKGTD 204
40555941 159 TSYWIDSRESGV-------CLIGTQNHIPEYPEVRKVSCDERHSFICIKKGTD 204
9634922  140 SRFWVDNRAAAStfdpvneCAYGTRSSVSEVPKVLTSPCSVRRYLVCKKTDNS 192
9634929  140 SRFWVDNRAAAStfdpvneCAYGTRSSVSEVPKVLTSPCSVRRYLVCKKTDNS 192
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap