Conserved Protein Domain Family
PHA02910

?
PHA02910: PHA02910 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165228
View PSSM: PHA02910
Aligned: 2 rows
Threshold Bit Score: 348.621
Threshold Setting Gi: 40555940
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40555940   1 MDKIPLIEKQNNSYNTRISTVRKISITSICVSLFLIGIIGGYIVGFYTTVSFNSNSGGEKRIGYHSWFCHYGACYKEVLM 80 
40556265   1 MDKIPLIEKQNNSYNTRISTVRKISITSICVSLFLIGIIGGYIVGFYTTVSFNSNSGGEKRIGYHSWFCHYGACYKEVLM 80 
40555940  81 PPSNYSHSKYVCEKLMNSKLPTRYDTIVMGLFSPIKNLENIWLTAEDGNDGIVNCSSVSYTQSSYYHNVTTIPCNSKIAT 160
40556265  81 PPSNYSHSKYVCEKLMNSKLPTRYDTIVMGLFSPIKNLENIWLTAEDGNDGIVNCSSVSYTQSSYYHNVTTIPCNSKIAT 160
40555940 161 VCMVKPIYNIA 171
40556265 161 VCMVKPIYNIA 171
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap