Conserved Protein Domain Family
PHA02909

?
PHA02909: PHA02909 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165227
View PSSM: PHA02909
Aligned: 2 rows
Threshold Bit Score: 108.109
Threshold Setting Gi: 40556266
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40556266  1 MDSKKQNPDPNYLMLSVDYGNGKKVYYTENTFCIMVSFILFVIIFLSMFTILACSYVYIAIIISLILLFFGC 72 
40555939  1 MDSKKQNPDPNYLMLSVDYGNGKKVYYTENTFCIMVSFILFVIIFLSMFTILACSYVYIAIIISLILLFFGC 72 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap