Conserved Protein Domain Family
PHA02907

?
PHA02907: PHA02907 
hypothetical protein; Provisional
Statistics
?
PSSM-Id: 165226
View PSSM: PHA02907
Aligned: 2 rows
Threshold Bit Score: 343.248
Threshold Setting Gi: 40555944
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
40555944   1 MNPRNSPEKYSPHKNSVSKMRPESSFNVSLYDASRIRASKHYPHTRFPNEDWTPKGILLRKYGKTKQSGNTKDVLEKSPD 80 
40556261   1 MNPRNSPEKYSPHKNSVSKMRPESSFNVSLYDASRIRASKHYPHTRFPNEDWTPKGILLRKYGKTKQSGNTKDVLEKSPD 80 
40555944  81 SVSPRELPIEKSYYKSIVYKTAAVMLLVVKIRDRLRFIRKLFRYVGDKLYAKAALTLVNRLVTPRIPVVKDLIPFYYAKK 160
40556261  81 SVSPRELPIEKSYYKSIVYKTAAVMLLVVKIRDRLRFIRKLFRYVGDKLYAKAALTLVNRLVTPRIPVVKDLIPFYYAKK 160
40555944 161 NFWKFALLYGLKKISDKAPKAR 182
40556261 161 NFWKFALLYGLKKISDKAPKAR 182
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap